GeneModel BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000561-TA|BGIBMGA000561-PA|undefined
         (66 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g22210.1 68417.m03210 hypothetical protein                          25   8.2  

>At4g22210.1 68417.m03210 hypothetical protein
          Length = 86

 Score = 24.6 bits (51), Expect = 8.2
 Identities = 17/62 (27%), Positives = 23/62 (37%), Gaps = 3/62 (4%)

Query: 1  MAVTVCSSPLLTQTPFSEEDCIRQGGICVRTEECDPDNISTISQFL---CPNQAHLGVAC 57
          +AV VC S LL         C    G+C     C+    S    F    C +    G++ 
Sbjct: 11 VAVVVCLSILLMSPTDGRRVCDSAAGLCSMLFSCNTQCNSLGRNFTGGECSDARFPGLSV 70

Query: 58 CY 59
          CY
Sbjct: 71 CY 72


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.323    0.135    0.435 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,680,413
Number of Sequences: 28952
Number of extensions: 53628
Number of successful extensions: 110
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 110
Number of HSP's gapped (non-prelim): 1
length of query: 66
length of database: 12,070,560
effective HSP length: 46
effective length of query: 20
effective length of database: 10,738,768
effective search space: 214775360
effective search space used: 214775360
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 51 (24.6 bits)