BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000559-TA|BGIBMGA000559-PA|IPR000652|Triosephosphate isomerase (174 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 7.4 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 7.4 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/31 (25%), Positives = 19/31 (61%) Query: 19 QINEIVNNLKKGPLDPNVEVAHALESGLKVI 49 ++NE++ ++KK P +++ LE +K + Sbjct: 341 EMNEVLGDIKKKPTYQDLQEMKYLERCVKEV 371 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/31 (25%), Positives = 19/31 (61%) Query: 19 QINEIVNNLKKGPLDPNVEVAHALESGLKVI 49 ++NE++ ++KK P +++ LE +K + Sbjct: 341 EMNEVLGDIKKKPTYQDLQEMKYLERCVKEV 371 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.131 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,801 Number of Sequences: 317 Number of extensions: 1501 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 174 length of database: 114,650 effective HSP length: 53 effective length of query: 121 effective length of database: 97,849 effective search space: 11839729 effective search space used: 11839729 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.0 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -