BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000550-TA|BGIBMGA000550-PA|undefined (1178 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 25 3.1 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 25 4.0 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 23 9.3 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 25.0 bits (52), Expect = 3.1 Identities = 10/37 (27%), Positives = 19/37 (51%) Query: 220 SEQENDEDEMSPTHWCWLHLSSQVIYLILIGFASFPN 256 S N+++E + +C + V+Y I +G+ F N Sbjct: 461 SNNNNNKEEGNSCQYCNIAFGDAVLYTIHMGYHGFHN 497 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 24.6 bits (51), Expect = 4.0 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 6/55 (10%) Query: 94 KGVREIMKQLAKLLTSFVESTKPCAQMVSIIGHSNMLPVVEFSGFADHLVNPWRL 148 +G+ + KQLA L + K + +SI LPV EF ++ + N W L Sbjct: 224 RGIPDTSKQLAAALGMQTTNEKEIFERLSI------LPVDEFLQISEEVANIWGL 272 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 23.4 bits (48), Expect = 9.3 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 747 VDAINDIIWKYNIVTIDRLVLCLVLR 772 ++ + DIIWK + V C V+R Sbjct: 76 INVLTDIIWKTTVAWYAGNVACKVIR 101 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.323 0.137 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 287,160 Number of Sequences: 317 Number of extensions: 12675 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 3 length of query: 1178 length of database: 114,650 effective HSP length: 64 effective length of query: 1114 effective length of database: 94,362 effective search space: 105119268 effective search space used: 105119268 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -