BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000549-TA|BGIBMGA000549-PA|IPR008758|Peptidase S28 (439 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 23 6.7 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 23 6.7 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.6 bits (46), Expect = 6.7 Identities = 11/36 (30%), Positives = 18/36 (50%) Query: 191 HSPEVIEKEFRVCKPFGLASQNDMKNFYNSIADDFA 226 H+P+ E F+V P + ++N N AD+ A Sbjct: 344 HAPKQTEVRFKVHDPKAHSKGGTLENTINGRADEEA 379 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.6 bits (46), Expect = 6.7 Identities = 11/36 (30%), Positives = 18/36 (50%) Query: 191 HSPEVIEKEFRVCKPFGLASQNDMKNFYNSIADDFA 226 H+P+ E F+V P + ++N N AD+ A Sbjct: 344 HAPKQTEVRFKVHDPKAHSKGGTLENTINGRADEEA 379 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.134 0.411 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,519 Number of Sequences: 429 Number of extensions: 6384 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 2 length of query: 439 length of database: 140,377 effective HSP length: 60 effective length of query: 379 effective length of database: 114,637 effective search space: 43447423 effective search space used: 43447423 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -