BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000549-TA|BGIBMGA000549-PA|IPR008758|Peptidase S28 (439 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 26 2.3 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 25 3.1 DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 25 4.1 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 24 9.4 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 25.8 bits (54), Expect = 2.3 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Query: 40 YQSNLPPPQWFKQKLDHSNPS----DLRTWKQVCIYQFIDKRDLSIKNL-QFL 87 Y++N +WF + DHS S D +T Q Q I ++ + NL QFL Sbjct: 85 YRNNERAVRWFSRSFDHSAKSTFEIDNQTVSQQAYLQQIRAFNIQVDNLCQFL 137 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 25.4 bits (53), Expect = 3.1 Identities = 11/32 (34%), Positives = 20/32 (62%) Query: 159 QVVVDALREKTGDDKCVNELRQAHNEISQLIQ 190 ++ DAL+E T D+ +NE + + + QLI+ Sbjct: 350 KITYDALKEMTYLDQVINETLRMYPPVPQLIR 381 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 25.0 bits (52), Expect = 4.1 Identities = 26/113 (23%), Positives = 46/113 (40%), Gaps = 6/113 (5%) Query: 208 LASQNDMKNFYNSIADDFADLVQYNEDNRISADVNYKNLTINTVCDMLTATGGLPAYKKL 267 L ND K + + DF + + S + L+I TV ++L G +++ Sbjct: 80 LTPDNDAK--ISQLVVDFMMRISRTLPQQQSRTELFSPLSIITVANLLFLGSGGSTHEE- 136 Query: 268 AAFNDIVLAKS-NETCMDYSYDNMISDLRNITWSSNGARQWMYQTCTEFGFYQ 319 F ++ S N M Y N++++L + + QW QTC Y+ Sbjct: 137 --FGKVLTPSSMNWKRMHQRYGNVLANLMSPEPIDSRRDQWRRQTCPRDDDYE 187 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.8 bits (49), Expect = 9.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Query: 31 GNLGIPGGDYQSNLPPPQ 48 GN G+PG Q LP PQ Sbjct: 609 GNDGLPGPQGQRGLPGPQ 626 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.134 0.411 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 464,253 Number of Sequences: 2123 Number of extensions: 18279 Number of successful extensions: 53 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 51 Number of HSP's gapped (non-prelim): 4 length of query: 439 length of database: 516,269 effective HSP length: 66 effective length of query: 373 effective length of database: 376,151 effective search space: 140304323 effective search space used: 140304323 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -