Silkworm BLAST Result against rice

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000547-TA|BGIBMGA000547-PA|IPR000832|GPCR, family 2,
secretin-like, IPR003287|Calcitonin receptor-related
         (75 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_1315 + 26083856-26083945,26084093-26084226,26084753-260848...    27   2.5  

>08_02_1315 +
          26083856-26083945,26084093-26084226,26084753-26084819,
          26085011-26085192,26085315-26085444
          Length = 200

 Score = 26.6 bits (56), Expect = 2.5
 Identities = 12/35 (34%), Positives = 21/35 (60%)

Query: 27 QYKRTRIHANLFISFILNNIMWIVWYKTVVDYIEV 61
          Q+KR      L + F+ N+ + +V Y +V+D +EV
Sbjct: 17 QFKRPHSDRYLCLKFVSNSWVGLVGYGSVLDLLEV 51


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.335    0.147    0.480 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,606,648
Number of Sequences: 37544
Number of extensions: 40052
Number of successful extensions: 105
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 104
Number of HSP's gapped (non-prelim): 1
length of query: 75
length of database: 14,793,348
effective HSP length: 54
effective length of query: 21
effective length of database: 12,765,972
effective search space: 268085412
effective search space used: 268085412
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (21.6 bits)
S2: 52 (25.0 bits)