BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000546-TA|BGIBMGA000546-PA|undefined (1221 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 27 3.0 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 26 6.9 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 27.1 bits (57), Expect = 3.0 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Query: 511 SSLTQDHMNLLIQFLNSSEENQEIWLTAFMVTVARHLFLMEPMQS-QNGEPILVPNEFNS 569 S L D M + + L + E++ ++TVA LFL + + +L P+ N Sbjct: 89 SQLVVDFMMRISRTLPQQQSRTELFSPLSIITVANLLFLGSGGSTHEEFGKVLTPSSMNW 148 Query: 570 VRIHLRH 576 R+H R+ Sbjct: 149 KRMHQRY 155 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 25.8 bits (54), Expect = 6.9 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Query: 561 ILVPNEFNSVRIHLRHYIQDLLNRADRCQGENAFQAVAD--YLVDQHEE 607 + V + F+ +HL +Q++++R R Q EN + + YL D+ +E Sbjct: 2064 LAVRHGFHKYFLHLSPGLQEVIDRFVRIQQENGHRITEEEYYLPDEDDE 2112 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.318 0.131 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 898,916 Number of Sequences: 2123 Number of extensions: 32135 Number of successful extensions: 64 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 64 Number of HSP's gapped (non-prelim): 2 length of query: 1221 length of database: 516,269 effective HSP length: 72 effective length of query: 1149 effective length of database: 363,413 effective search space: 417561537 effective search space used: 417561537 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -