BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000546-TA|BGIBMGA000546-PA|undefined (1221 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY273823-1|AAQ01772.1| 1040|Caenorhabditis elegans VAB-19 protein. 30 8.8 AC006688-1|AAF39969.3| 1040|Caenorhabditis elegans Variable abno... 30 8.8 >AY273823-1|AAQ01772.1| 1040|Caenorhabditis elegans VAB-19 protein. Length = 1040 Score = 30.3 bits (65), Expect = 8.8 Identities = 15/37 (40%), Positives = 20/37 (54%) Query: 1053 SNSSTVPPQNEANGRSPVGASRNGNVSPDLQFVSPVV 1089 S S++ PPQ A+ PV NG+ SP Q P+V Sbjct: 360 STSTSPPPQAPASAFEPVKPLSNGSPSPTHQVQKPIV 396 >AC006688-1|AAF39969.3| 1040|Caenorhabditis elegans Variable abnormal morphology protein19 protein. Length = 1040 Score = 30.3 bits (65), Expect = 8.8 Identities = 15/37 (40%), Positives = 20/37 (54%) Query: 1053 SNSSTVPPQNEANGRSPVGASRNGNVSPDLQFVSPVV 1089 S S++ PPQ A+ PV NG+ SP Q P+V Sbjct: 360 STSTSPPPQAPASAFEPVKPLSNGSPSPTHQVQKPIV 396 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.318 0.131 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,783,611 Number of Sequences: 27539 Number of extensions: 803737 Number of successful extensions: 2062 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2058 Number of HSP's gapped (non-prelim): 4 length of query: 1221 length of database: 12,573,161 effective HSP length: 90 effective length of query: 1131 effective length of database: 10,094,651 effective search space: 11417050281 effective search space used: 11417050281 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -