BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000545-TA|BGIBMGA000545-PA|IPR000225|Armadillo (767 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 29 0.12 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 4.5 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 23 5.9 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 29.1 bits (62), Expect = 0.12 Identities = 16/42 (38%), Positives = 22/42 (52%) Query: 553 PQNCQRFLENRGMEFFLACLKNFPDNEELLRNMMGLLGNVAE 594 P NC L + + C KN P EL +++ GLL NVA+ Sbjct: 716 PANCSPDLYAVMLNCWKECPKNRPTFTELSKSLEGLLENVAQ 757 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.8 bits (49), Expect = 4.5 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Query: 98 TDEGFRFLMEHKPQEVELIQCEYLSPMSLETINRNSRNLVSLKFG-PATHVLA-QDESAY 155 T + F M E ++IQ Y+S L+ +N + L+S+ G +H + SA Sbjct: 213 TIDPHNFNMISNDDESDIIQGGYISVTGLKRVNPKLKVLISVGEGRDGSHRFSTMVSSAN 272 Query: 156 KQRGFI 161 ++R FI Sbjct: 273 RRREFI 278 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 23.4 bits (48), Expect = 5.9 Identities = 9/35 (25%), Positives = 19/35 (54%) Query: 657 VATAVERWDLHAERNINYRSFEPILSLLHAHHTPQ 691 VA + R+ E + Y +PI+++ ++TP+ Sbjct: 26 VADILSRYPSDGEASYEYPREQPIVAMFEVNNTPE 60 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.137 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,019 Number of Sequences: 317 Number of extensions: 7629 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 3 length of query: 767 length of database: 114,650 effective HSP length: 62 effective length of query: 705 effective length of database: 94,996 effective search space: 66972180 effective search space used: 66972180 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -