BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000543-TA|BGIBMGA000543-PA|undefined (118 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 20 7.3 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 20 7.3 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 20 7.3 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 19 9.7 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 19.8 bits (39), Expect = 7.3 Identities = 9/22 (40%), Positives = 11/22 (50%) Query: 45 GTGTVLVVCQRINAYEEIARAL 66 GT +L QR N Y + A L Sbjct: 215 GTSAMLAAYQRYNPYLQAASML 236 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 19.8 bits (39), Expect = 7.3 Identities = 11/30 (36%), Positives = 14/30 (46%) Query: 70 FSTETKIGLDISYSQLPDFAEHSFRELGLS 99 F ++ DISYSQ E +L LS Sbjct: 175 FQALLRMDRDISYSQRMARVEEVISDLALS 204 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 19.8 bits (39), Expect = 7.3 Identities = 11/30 (36%), Positives = 14/30 (46%) Query: 70 FSTETKIGLDISYSQLPDFAEHSFRELGLS 99 F ++ DISYSQ E +L LS Sbjct: 175 FQALLRMDRDISYSQRMARVEEVISDLALS 204 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 19.4 bits (38), Expect = 9.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 95 ELGLSITRLKLNFDNLR 111 ELGL+ ++K+ F N R Sbjct: 264 ELGLNEAQIKIWFQNKR 280 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.324 0.135 0.406 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,706 Number of Sequences: 317 Number of extensions: 608 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 118 length of database: 114,650 effective HSP length: 50 effective length of query: 68 effective length of database: 98,800 effective search space: 6718400 effective search space used: 6718400 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.7 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -