BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000543-TA|BGIBMGA000543-PA|undefined (118 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 0.93 AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding pr... 21 3.8 M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-... 20 6.6 M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 20 6.6 DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 20 6.6 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.0 bits (47), Expect = 0.93 Identities = 9/31 (29%), Positives = 16/31 (51%) Query: 59 YEEIARALTNKFSTETKIGLDISYSQLPDFA 89 Y +A + N+F +T+ L + LPD + Sbjct: 41 YRSVATQVFNRFGDDTESKLPVKAITLPDLS 71 >AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding protein protein. Length = 135 Score = 21.0 bits (42), Expect = 3.8 Identities = 7/24 (29%), Positives = 16/24 (66%) Query: 68 NKFSTETKIGLDISYSQLPDFAEH 91 N F TET++ + ++L +F+++ Sbjct: 90 NTFKTETQVNDSLKVTRLYEFSDN 113 >M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E30. ). Length = 109 Score = 20.2 bits (40), Expect = 6.6 Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 94 RELGLSITRLKLNFDNLR 111 R+LGL+ ++K+ F N R Sbjct: 55 RDLGLTEAQIKIWFQNKR 72 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 20.2 bits (40), Expect = 6.6 Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 94 RELGLSITRLKLNFDNLR 111 R+LGL+ ++K+ F N R Sbjct: 55 RDLGLNEAQIKIWFQNKR 72 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 20.2 bits (40), Expect = 6.6 Identities = 11/41 (26%), Positives = 19/41 (46%) Query: 69 KFSTETKIGLDISYSQLPDFAEHSFRELGLSITRLKLNFDN 109 KF+ K I Y+ L +F+E+G+ + N D+ Sbjct: 78 KFNVMDKKNGKIRYNLLKKVIPEAFKEIGVEMIDSCSNVDS 118 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.324 0.135 0.406 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,341 Number of Sequences: 429 Number of extensions: 799 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 118 length of database: 140,377 effective HSP length: 51 effective length of query: 67 effective length of database: 118,498 effective search space: 7939366 effective search space used: 7939366 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (21.1 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -