BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000543-TA|BGIBMGA000543-PA|undefined (118 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77470.1 68414.m09021 replication factor C 36 kDA, putative s... 27 4.4 At5g44820.1 68418.m05493 expressed protein similar to unknown pr... 26 5.8 At3g58710.2 68416.m06544 WRKY family transcription factor contai... 26 5.8 At3g58710.1 68416.m06543 WRKY family transcription factor contai... 26 5.8 At3g03960.1 68416.m00415 chaperonin, putative similar to SWISS-P... 26 5.8 At1g17260.1 68414.m02102 ATPase 10, plasma membrane-type, putati... 26 5.8 At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ... 26 7.6 At4g36050.2 68417.m05132 endonuclease/exonuclease/phosphatase fa... 26 7.6 At4g36050.1 68417.m05131 endonuclease/exonuclease/phosphatase fa... 26 7.6 >At1g77470.1 68414.m09021 replication factor C 36 kDA, putative similar to SWISS-PROT:P40937 activator 1 36 kDa subunit (Replication factor C 36 kDa subunit, A1 36 kDa subunit, RF-C 36 kDa subunit, RFC36) [Homo sapiens] Length = 369 Score = 26.6 bits (56), Expect = 4.4 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Query: 46 TGTVLVVCQRINAYEEIARALTNKFSTETKIGLDISYSQLPDFAEHSFRELGLSITRLKL 105 T T+L V +++ Y R + + + G+D+ Q+ DFA LG S +L L Sbjct: 86 TSTILAVARKL--YGPKYRNMILELNASDDRGIDVVRQQIQDFASTQSFSLGKSSVKLVL 143 >At5g44820.1 68418.m05493 expressed protein similar to unknown protein (pir||T04881) Length = 367 Score = 26.2 bits (55), Expect = 5.8 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Query: 49 VLVVCQRINAYEEIARALTNKFSTETKIGLDISYSQL---PDFAEHSFRELGLSITRLKL 105 V+VVC I A+E ++ TN + ET D S ++ PD+ + + + L L++ Sbjct: 142 VVVVCLDIKAFERCSQLHTNCYHIETS-ETDFSGEKVYNTPDYLKMMWARIDLLTQVLEM 200 Query: 106 NFD 108 F+ Sbjct: 201 GFN 203 >At3g58710.2 68416.m06544 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 271 Score = 26.2 bits (55), Expect = 5.8 Identities = 15/52 (28%), Positives = 23/52 (44%) Query: 46 TGTVLVVCQRINAYEEIARALTNKFSTETKIGLDISYSQLPDFAEHSFRELG 97 + VL ++ YEE LT + E GLD+S+ P + E+G Sbjct: 142 SSVVLKTAKKEEEYEEEEEELTVTAAEEPPAGLDLSHVDSPLLLGGCYSEIG 193 >At3g58710.1 68416.m06543 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 272 Score = 26.2 bits (55), Expect = 5.8 Identities = 15/52 (28%), Positives = 23/52 (44%) Query: 46 TGTVLVVCQRINAYEEIARALTNKFSTETKIGLDISYSQLPDFAEHSFRELG 97 + VL ++ YEE LT + E GLD+S+ P + E+G Sbjct: 143 SSVVLKTAKKEEEYEEEEEELTVTAAEEPPAGLDLSHVDSPLLLGGCYSEIG 194 >At3g03960.1 68416.m00415 chaperonin, putative similar to SWISS-PROT:P42932- T-complex protein 1, theta subunit (TCP-1-theta) [Mus musculus]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 549 Score = 26.2 bits (55), Expect = 5.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 56 INAYEEIARALTNKFSTETKIGLDISYSQLPDFAE 90 +NA E IA T S TK+G+D+ D +E Sbjct: 461 LNAMEIIAALYTGHGSGNTKLGIDLEEGACKDVSE 495 >At1g17260.1 68414.m02102 ATPase 10, plasma membrane-type, putative / proton pump 10, putative / proton-exporting ATPase, putative strong similarity to SP|Q43128 ATPase 10, plasma membrane-type (EC 3.6.3.6) (Proton pump 10) {Arabidopsis thaliana}; contains InterPro accession IPR001757: ATPase, E1-E2 type; contains Pfam profile PF00690: Cation transporter/ATPase, N-terminus Length = 947 Score = 26.2 bits (55), Expect = 5.8 Identities = 11/44 (25%), Positives = 26/44 (59%) Query: 49 VLVVCQRINAYEEIARALTNKFSTETKIGLDISYSQLPDFAEHS 92 VL +CQ+ N + A+ ++F+ + L ++Y ++P+ + +S Sbjct: 437 VLNLCQQKNEIAQRVYAIIDRFAEKGLRSLAVAYQEIPEKSNNS 480 >At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, EMBL:D86122 Length = 915 Score = 25.8 bits (54), Expect = 7.6 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Query: 47 GTVLVVCQRINAYEEIARALTNKFSTETKIGLDISYS 83 G ++V I A + ARAL NK TK LDI YS Sbjct: 254 GFIMVSYCDIRAAQNAARALQNKLLRGTK--LDIRYS 288 >At4g36050.2 68417.m05132 endonuclease/exonuclease/phosphatase family protein Length = 609 Score = 25.8 bits (54), Expect = 7.6 Identities = 11/27 (40%), Positives = 14/27 (51%) Query: 66 LTNKFSTETKIGLDISYSQLPDFAEHS 92 L KF + + IS+ LPD EHS Sbjct: 315 LVTKFKGSDHVPVFISFDDLPDIPEHS 341 >At4g36050.1 68417.m05131 endonuclease/exonuclease/phosphatase family protein Length = 408 Score = 25.8 bits (54), Expect = 7.6 Identities = 11/27 (40%), Positives = 14/27 (51%) Query: 66 LTNKFSTETKIGLDISYSQLPDFAEHS 92 L KF + + IS+ LPD EHS Sbjct: 114 LVTKFKGSDHVPVFISFDDLPDIPEHS 140 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.324 0.135 0.406 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,068,514 Number of Sequences: 28952 Number of extensions: 65299 Number of successful extensions: 208 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 202 Number of HSP's gapped (non-prelim): 9 length of query: 118 length of database: 12,070,560 effective HSP length: 72 effective length of query: 46 effective length of database: 9,986,016 effective search space: 459356736 effective search space used: 459356736 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -