BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000540-TA|BGIBMGA000540-PA|IPR000195|RabGAP/TBC (894 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 27 0.43 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 23 7.0 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 7.0 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 7.0 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 7.0 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 7.0 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 27.5 bits (58), Expect = 0.43 Identities = 16/87 (18%), Positives = 40/87 (45%), Gaps = 2/87 (2%) Query: 432 LAYSVKVNPKKMKKLEKEYTVIKTKEQGDIA--VLRCLRQENRLLKQRVXXXXXXXXXXX 489 +AY + NP KKL+KE + + G I+ VL+ ++ ++++ + + Sbjct: 291 MAYELATNPHVQKKLQKEIDLTLQENHGKISYNVLQSMKYLDQVVCESLRLWPPAPQTDR 350 Query: 490 XXXVRGQVDRAEGEEETFALDREVQAL 516 ++ ++ E TF ++++ + Sbjct: 351 LCNKNFVIEASKPHERTFTVEKDTMVM 377 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 23.4 bits (48), Expect = 7.0 Identities = 7/27 (25%), Positives = 17/27 (62%) Query: 823 SDRVRELQEQVAELKAEIMRLEAWKSR 849 + ++R+L +V ++K ++ L+ W R Sbjct: 288 NQKLRDLNREVDQIKQDVEDLKRWSDR 314 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.4 bits (48), Expect = 7.0 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Query: 706 EALTELKELRLKVMELETQVQVSTNQLRRQDEEARLLRENLDAALQRER 754 E L ++L + M + S RR+D+EA + E+LD +Q+E+ Sbjct: 487 ERLARTEKLFVTPMYEGLLIDQSLGMNRRRDDEADVKTEDLD-EIQKEK 534 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.4 bits (48), Expect = 7.0 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Query: 706 EALTELKELRLKVMELETQVQVSTNQLRRQDEEARLLRENLDAALQRER 754 E L ++L + M + S RR+D+EA + E+LD +Q+E+ Sbjct: 487 ERLARTEKLFVTPMYEGLLIDQSLGMNRRRDDEADVKTEDLD-EIQKEK 534 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.4 bits (48), Expect = 7.0 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Query: 706 EALTELKELRLKVMELETQVQVSTNQLRRQDEEARLLRENLDAALQRER 754 E L ++L + M + S RR+D+EA + E+LD +Q+E+ Sbjct: 487 ERLARTEKLFVTPMYEGLLIDQSLGMNRRRDDEADVKTEDLD-EIQKEK 534 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.4 bits (48), Expect = 7.0 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Query: 706 EALTELKELRLKVMELETQVQVSTNQLRRQDEEARLLRENLDAALQRER 754 E L ++L + M + S RR+D+EA + E+LD +Q+E+ Sbjct: 487 ERLARTEKLFVTPMYEGLLIDQSLGMNRRRDDEADVKTEDLD-EIQKEK 534 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.130 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,898 Number of Sequences: 317 Number of extensions: 5409 Number of successful extensions: 16 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 10 length of query: 894 length of database: 114,650 effective HSP length: 63 effective length of query: 831 effective length of database: 94,679 effective search space: 78678249 effective search space used: 78678249 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -