BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000539-TA|BGIBMGA000539-PA|undefined (634 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 24 3.7 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 23 6.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 8.5 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.8 bits (49), Expect = 3.7 Identities = 10/45 (22%), Positives = 20/45 (44%) Query: 71 KDLVVGSNTELRTKLNRMDKKVTINQRPNLNLPPPSANVPTPAVT 115 K + V + + K+ D T + ++ LP + +P P +T Sbjct: 1295 KKVTVSPSASVPAKIASFDDTFTTTYKEDVTLPCLAVGLPPPVIT 1339 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 23.0 bits (47), Expect = 6.4 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 138 DNRTNPYYFNSDLNKSKTLTQEPFNLPKVTETDVTSYLPSDLTVP 182 D R NP+ F + + L + +L + T T S LT+P Sbjct: 508 DERGNPWLFRNQKDMFIELDRFAVSLKQGTNTITRHSTESSLTIP 552 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 8.5 Identities = 14/49 (28%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Query: 77 SNTELRTKLNRMDKKVTINQRPNLNLPPPSANVPTPAVTSTVVKSEPNQ 125 + T RT R T + N P +P PAV V +P+Q Sbjct: 1054 TTTTRRTTTTRPTTTSTTTRPTTTNWPTQGTTIPPPAVVMPEV-DKPSQ 1101 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.309 0.127 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,595 Number of Sequences: 317 Number of extensions: 5871 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 3 length of query: 634 length of database: 114,650 effective HSP length: 61 effective length of query: 573 effective length of database: 95,313 effective search space: 54614349 effective search space used: 54614349 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -