GeneModel BLAST Result against rice

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000534-TA|BGIBMGA000534-PA|undefined
         (72 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_02_0549 - 9395978-9396428,9396517-9396863                           25   7.5  

>03_02_0549 - 9395978-9396428,9396517-9396863
          Length = 265

 Score = 25.0 bits (52), Expect = 7.5
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query: 7   VNYVRSDLTSHVTGWPADILEKQANKFTEEAYQLGCLQCTRVSSELKCARSL 58
           V  V S  T+ V+   +  L +  +++T      G  QCTR  S L CA+ L
Sbjct: 157 VGKVMSKATAQVSQAGSGGLGRVKDQYTPFINIYGFAQCTRDLSPLTCAQCL 208


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.316    0.127    0.369 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,756,084
Number of Sequences: 37544
Number of extensions: 49297
Number of successful extensions: 84
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 83
Number of HSP's gapped (non-prelim): 1
length of query: 72
length of database: 14,793,348
effective HSP length: 52
effective length of query: 20
effective length of database: 12,841,060
effective search space: 256821200
effective search space used: 256821200
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 51 (24.6 bits)