BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000533-TA|BGIBMGA000533-PA|undefined (145 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 24 1.7 AY146719-1|AAO12079.1| 159|Anopheles gambiae odorant-binding pr... 22 9.2 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 24.2 bits (50), Expect = 1.7 Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 42 LTIGTHHFDHL-MAMCPHMAITHIQASPVIV 71 +T+G H FDH + P++A P +V Sbjct: 122 MTLGNHEFDHSPKGLAPYLAELEKMKIPTVV 152 >AY146719-1|AAO12079.1| 159|Anopheles gambiae odorant-binding protein AgamOBP2 protein. Length = 159 Score = 21.8 bits (44), Expect = 9.2 Identities = 9/34 (26%), Positives = 20/34 (58%) Query: 65 QASPVIVITTTVIWQMIEDMSHLEIPIFRKSPKR 98 QASP++++ ++ Q ++ + I R +P+R Sbjct: 4 QASPLLLLLLLLVTQCLDGANCSTITTQRPAPRR 37 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.324 0.132 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,342 Number of Sequences: 2123 Number of extensions: 4497 Number of successful extensions: 36 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 35 Number of HSP's gapped (non-prelim): 2 length of query: 145 length of database: 516,269 effective HSP length: 58 effective length of query: 87 effective length of database: 393,135 effective search space: 34202745 effective search space used: 34202745 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -