BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000530-TA|BGIBMGA000530-PA|IPR009635|Neural proliferation differentiation control-1 (361 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory pro... 25 0.64 EF222288-1|ABN79648.1| 73|Tribolium castaneum adipokinetic hor... 24 2.0 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 7.9 >DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory protein 17 protein. Length = 124 Score = 25.4 bits (53), Expect = 0.64 Identities = 26/101 (25%), Positives = 46/101 (45%), Gaps = 9/101 (8%) Query: 102 DEKEFNDLITKNFMSRIMEVGSPVPKQVYSSGGSNKAEI--NLKHANIPAPHSDINSARP 159 DE ND +TKN++ I+E G P+ G K +I L++ R Sbjct: 30 DEILKNDRLTKNYLDCILEKGKCTPE-----GEELKKDIPDALQNECAKCNEKHKEGVRK 84 Query: 160 IVQPQSFNIPDEPKEITEK-ETKGFALTPFNKEYYEEQNIS 199 +++ N P +E+ EK + KG + +N + EE+ ++ Sbjct: 85 VIRHLIKNKPSWWQELQEKYDPKGEYKSRYN-HFLEEEGLN 124 >EF222288-1|ABN79648.1| 73|Tribolium castaneum adipokinetic hormone 1 protein. Length = 73 Score = 23.8 bits (49), Expect = 2.0 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Query: 132 SGGSNKAEINLKHANIPAPHSDINSARPIVQPQSFNIPDEPKEI 175 SG S ++ N N P I I+Q FNIP+ P++I Sbjct: 31 SGSSAGSDAN----NCKEPVETIMLIYKIIQVSFFNIPNSPQQI 70 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.8 bits (44), Expect = 7.9 Identities = 8/20 (40%), Positives = 10/20 (50%) Query: 325 PTVDSSGDRKLAQSAHMYHY 344 PT +S D K+ H Y Y Sbjct: 377 PTAESKADIKMYADMHQYGY 396 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.131 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,999 Number of Sequences: 317 Number of extensions: 4199 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 3 length of query: 361 length of database: 114,650 effective HSP length: 58 effective length of query: 303 effective length of database: 96,264 effective search space: 29167992 effective search space used: 29167992 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -