GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000530-TA|BGIBMGA000530-PA|IPR009635|Neural
proliferation differentiation control-1
         (361 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY347952-1|AAR28375.1|  634|Anopheles gambiae putative sulfakini...    29   0.15 

>AY347952-1|AAR28375.1|  634|Anopheles gambiae putative sulfakinin
           GPCR protein.
          Length = 634

 Score = 29.5 bits (63), Expect = 0.15
 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 1/64 (1%)

Query: 269 SGSSDPSDSIFGVALMAAIGTALTMAILGFAFGWYTLSKRAKAAADVDYPAYGVTGPTVD 328
           S + D  D ++G  L  A+G  L   I     G + LS   ++AA    PA G TG    
Sbjct: 41  SMAGDYGDELYGTNLSLALGELLRDNISATVVGTHNLSGNGRSAAGNLPPATG-TGTAGS 99

Query: 329 SSGD 332
             GD
Sbjct: 100 RGGD 103


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.313    0.131    0.377 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 381,110
Number of Sequences: 2123
Number of extensions: 16820
Number of successful extensions: 24
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 23
Number of HSP's gapped (non-prelim): 1
length of query: 361
length of database: 516,269
effective HSP length: 65
effective length of query: 296
effective length of database: 378,274
effective search space: 111969104
effective search space used: 111969104
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 48 (23.4 bits)