BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000529-TA|BGIBMGA000529-PA|IPR006025|Peptidase M, neutral zinc metallopeptidases, zinc-binding site, IPR000718|Peptidase M13, neprilysin, IPR008753|Peptidase M13 (761 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 28 0.21 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 24 3.4 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 28.3 bits (60), Expect = 0.21 Identities = 12/41 (29%), Positives = 21/41 (51%) Query: 380 YVMWRVAGASVSYLTDDLRRRQLAYITALSGKTERESRWKE 420 +++W + G DL RR++A + L+ K E + R E Sbjct: 251 FILWHIVGTFSGIFLCDLIRREIANVQVLAYKIEAKRRDNE 291 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/40 (27%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Query: 80 ETCSAPGCIHTASRLLLNMDEKVDPCDNFYDFACGSFLKN 119 E C+ P C+ + +E + PC+ YD C N Sbjct: 545 EDCNNPECLFDGR----DCEESLQPCNPIYDAYCQKHYAN 580 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.133 0.399 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,399 Number of Sequences: 317 Number of extensions: 7208 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 2 length of query: 761 length of database: 114,650 effective HSP length: 62 effective length of query: 699 effective length of database: 94,996 effective search space: 66402204 effective search space used: 66402204 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -