BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000529-TA|BGIBMGA000529-PA|IPR006025|Peptidase M, neutral zinc metallopeptidases, zinc-binding site, IPR000718|Peptidase M13, neprilysin, IPR008753|Peptidase M13 (761 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 9.3 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 23.0 bits (47), Expect = 9.3 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Query: 263 KLVQAYYEYMVDIAILLGADKTKATEELKESLQFEMKLANISLPLEKRRN 312 +L++ E +V++ LL + +EL+ L ++ A++ L E RRN Sbjct: 9 ELLRVKDEKIVELEALL-CRRDAEIQELRSHLDKFLQCASLKLAFEPRRN 57 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.318 0.133 0.399 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,383 Number of Sequences: 429 Number of extensions: 9210 Number of successful extensions: 93 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 93 Number of HSP's gapped (non-prelim): 1 length of query: 761 length of database: 140,377 effective HSP length: 63 effective length of query: 698 effective length of database: 113,350 effective search space: 79118300 effective search space used: 79118300 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -