GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000529-TA|BGIBMGA000529-PA|IPR006025|Peptidase M,
neutral zinc metallopeptidases, zinc-binding site, IPR000718|Peptidase
M13, neprilysin, IPR008753|Peptidase M13
         (761 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    23   9.3  

>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 23.0 bits (47), Expect = 9.3
 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 263 KLVQAYYEYMVDIAILLGADKTKATEELKESLQFEMKLANISLPLEKRRN 312
           +L++   E +V++  LL   +    +EL+  L   ++ A++ L  E RRN
Sbjct: 9   ELLRVKDEKIVELEALL-CRRDAEIQELRSHLDKFLQCASLKLAFEPRRN 57


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.318    0.133    0.399 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 214,383
Number of Sequences: 429
Number of extensions: 9210
Number of successful extensions: 93
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 93
Number of HSP's gapped (non-prelim): 1
length of query: 761
length of database: 140,377
effective HSP length: 63
effective length of query: 698
effective length of database: 113,350
effective search space: 79118300
effective search space used: 79118300
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 47 (23.0 bits)