BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000525-TA|BGIBMGA000525-PA|undefined (60 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0435 - 8406262-8406419,8406499-8406547,8406577-8407458,840... 25 5.8 01_01_1155 + 9191249-9192439 25 5.8 >03_02_0435 - 8406262-8406419,8406499-8406547,8406577-8407458, 8408976-8409127,8410346-8410616 Length = 503 Score = 25.4 bits (53), Expect = 5.8 Identities = 14/44 (31%), Positives = 18/44 (40%) Query: 6 YLYVQPVLFYPYGRFPVSWNASNQHMKRERSNTQALESNPNCLY 49 YL V PV+ Y F A +H +R + SNP Y Sbjct: 372 YLVVVPVVVVIYSLFAEKAVACLRHSRRTENTVNPTNSNPESGY 415 >01_01_1155 + 9191249-9192439 Length = 396 Score = 25.4 bits (53), Expect = 5.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Query: 22 VSWNASNQHMKRERSNTQALE 42 VSW AS H++R R T +E Sbjct: 340 VSWAASRLHVRRRRVRTSKIE 360 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.322 0.134 0.435 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,887,194 Number of Sequences: 37544 Number of extensions: 54997 Number of successful extensions: 85 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 83 Number of HSP's gapped (non-prelim): 2 length of query: 60 length of database: 14,793,348 effective HSP length: 40 effective length of query: 20 effective length of database: 13,291,588 effective search space: 265831760 effective search space used: 265831760 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -