Silkworm BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000522-TA|BGIBMGA000522-PA|IPR011009|Protein kinase-like
         (192 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cycl...    23   1.9  
AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    21   5.8  
AY569719-1|AAS86672.1|  401|Apis mellifera complementary sex det...    21   7.6  
AY569718-1|AAS86671.1|  401|Apis mellifera complementary sex det...    21   7.6  
AY569715-1|AAS86668.1|  401|Apis mellifera complementary sex det...    21   7.6  
AY569714-1|AAS86667.1|  401|Apis mellifera complementary sex det...    21   7.6  
AY569713-1|AAS86666.1|  401|Apis mellifera complementary sex det...    21   7.6  
AY569711-1|AAS86664.1|  401|Apis mellifera complementary sex det...    21   7.6  
AY569702-1|AAS86655.1|  400|Apis mellifera complementary sex det...    21   7.6  
AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex det...    21   7.6  

>AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cyclase
           beta-3 protein.
          Length = 832

 Score = 23.0 bits (47), Expect = 1.9
 Identities = 11/41 (26%), Positives = 17/41 (41%)

Query: 129 LRPMFPYVKKDEWVKEENEFKRFKKYAEPSFGKHYRYPSKI 169
           L  M  Y+++        E +R     +PSF  H  YP  +
Sbjct: 6   LENMSEYIRQVYGEDRWEEIRRQASVEQPSFSVHQVYPENL 46


>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 21.4 bits (43), Expect = 5.8
 Identities = 8/16 (50%), Positives = 12/16 (75%)

Query: 171 HNFKSEETKETIENVD 186
           H F S++ K+T+EN D
Sbjct: 114 HKFISKKIKKTMENKD 129


>AY569719-1|AAS86672.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 21.0 bits (42), Expect = 7.6
 Identities = 9/13 (69%), Positives = 9/13 (69%)

Query: 143 KEENEFKRFKKYA 155
           K ENE K  KKYA
Sbjct: 199 KSENETKTCKKYA 211


>AY569718-1|AAS86671.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 21.0 bits (42), Expect = 7.6
 Identities = 9/13 (69%), Positives = 9/13 (69%)

Query: 143 KEENEFKRFKKYA 155
           K ENE K  KKYA
Sbjct: 199 KSENETKTCKKYA 211


>AY569715-1|AAS86668.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 21.0 bits (42), Expect = 7.6
 Identities = 9/13 (69%), Positives = 9/13 (69%)

Query: 143 KEENEFKRFKKYA 155
           K ENE K  KKYA
Sbjct: 199 KSENETKTCKKYA 211


>AY569714-1|AAS86667.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 21.0 bits (42), Expect = 7.6
 Identities = 9/13 (69%), Positives = 9/13 (69%)

Query: 143 KEENEFKRFKKYA 155
           K ENE K  KKYA
Sbjct: 199 KSENETKTCKKYA 211


>AY569713-1|AAS86666.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 21.0 bits (42), Expect = 7.6
 Identities = 9/13 (69%), Positives = 9/13 (69%)

Query: 143 KEENEFKRFKKYA 155
           K ENE K  KKYA
Sbjct: 199 KSENETKTCKKYA 211


>AY569711-1|AAS86664.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 21.0 bits (42), Expect = 7.6
 Identities = 9/13 (69%), Positives = 9/13 (69%)

Query: 143 KEENEFKRFKKYA 155
           K ENE K  KKYA
Sbjct: 199 KSENETKTCKKYA 211


>AY569702-1|AAS86655.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 21.0 bits (42), Expect = 7.6
 Identities = 9/13 (69%), Positives = 9/13 (69%)

Query: 143 KEENEFKRFKKYA 155
           K ENE K  KKYA
Sbjct: 199 KSENETKTCKKYA 211


>AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 21.0 bits (42), Expect = 7.6
 Identities = 9/13 (69%), Positives = 9/13 (69%)

Query: 143 KEENEFKRFKKYA 155
           K ENE K  KKYA
Sbjct: 199 KSENETKTCKKYA 211


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.323    0.139    0.450 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 66,617
Number of Sequences: 429
Number of extensions: 3470
Number of successful extensions: 10
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of query: 192
length of database: 140,377
effective HSP length: 54
effective length of query: 138
effective length of database: 117,211
effective search space: 16175118
effective search space used: 16175118
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 42 (21.0 bits)