BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000519-TA|BGIBMGA000519-PA|undefined (108 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1513 - 37884198-37884485,37884966-37886951,37886976-378873... 27 4.1 02_01_0041 + 279583-281622,281724-282047,282315-282443,282526-28... 26 5.5 03_02_0203 + 6370729-6370850,6371213-6371391,6371516-6371625,637... 25 9.6 >01_06_1513 - 37884198-37884485,37884966-37886951,37886976-37887305, 37887397-37887471,37887543-37887734,37887922-37888173, 37888248-37888803,37888881-37889088,37889624-37889736, 37890029-37890060,37890545-37890619 Length = 1368 Score = 26.6 bits (56), Expect = 4.1 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 69 HKTKGQDSPFNPERPPEGTSQRDN 92 H+ +GQ +P PE+ P+G + N Sbjct: 808 HRLRGQQAPVLPEQKPDGEVRMSN 831 >02_01_0041 + 279583-281622,281724-282047,282315-282443,282526-282648, 282768-282923,283224-283349,283426-283560,283815-283942, 284037-284148,284233-284547,284655-284771,284871-285166, 285252-285783,287980-288082,288808-288881,288965-289062, 289340-289380,289977-290032,290170-290244,290377-290469, 290602-290850,290930-291002,291681-291766,291853-291938, 292067-292142,292280-292347,292430-292496,292570-292665, 292741-292843,293214-293309,293396-293466 Length = 2047 Score = 26.2 bits (55), Expect = 5.5 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Query: 76 SPFNP--ERPPEGTSQRDNRYLVHYAHRNANWA 106 SP P E PPEG S + VH + WA Sbjct: 62 SPAPPPVEAPPEGASPESGKGAVHTTVKQVQWA 94 >03_02_0203 + 6370729-6370850,6371213-6371391,6371516-6371625, 6372721-6373575 Length = 421 Score = 25.4 bits (53), Expect = 9.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Query: 13 HQYNVPETTFPQYGFPQSINLN 34 H + +P P YG SINLN Sbjct: 225 HGHQLPTVELPSYGRTASINLN 246 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.315 0.132 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,179,432 Number of Sequences: 37544 Number of extensions: 100305 Number of successful extensions: 98 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 95 Number of HSP's gapped (non-prelim): 3 length of query: 108 length of database: 14,793,348 effective HSP length: 72 effective length of query: 36 effective length of database: 12,090,180 effective search space: 435246480 effective search space used: 435246480 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -