BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000518-TA|BGIBMGA000518-PA|IPR001932|Protein phosphatase 2C-like, IPR000222|Protein phosphatase 2C (445 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 26 1.8 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 25 3.1 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 25 3.1 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 25 3.1 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 25 3.1 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 25 3.1 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 25 4.1 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 25 5.5 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 25 5.5 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 25 5.5 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 25 5.5 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 25 5.5 CR954257-6|CAJ14157.1| 375|Anopheles gambiae RrnaAD, ribosomal ... 24 7.2 CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. 24 7.2 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 24 7.2 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 26.2 bits (55), Expect = 1.8 Identities = 9/25 (36%), Positives = 18/25 (72%), Gaps = 3/25 (12%) Query: 222 EWIAKKITKEHNSENFDELKRIWNE 246 +W+A +K+H+S FDE ++W++ Sbjct: 952 DWLA---SKQHSSGRFDETGKVWHK 973 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 25.4 bits (53), Expect = 3.1 Identities = 15/63 (23%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 144 HEGYNVPTALEQAIIKIDQDLSKEAVEPYKLNQVIN-PQTLSVALSGAVACVTHVDGPNL 202 H G+N E + +KI Q + K +P ++ + P + A + H P Sbjct: 141 HTGFNAVVRREPSAVKIAQPVHKVIAQPVHVSSYAHAPVAHATVQHHHAAPIAHYSAPIA 200 Query: 203 HIA 205 H A Sbjct: 201 HHA 203 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 25.4 bits (53), Expect = 3.1 Identities = 15/63 (23%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 144 HEGYNVPTALEQAIIKIDQDLSKEAVEPYKLNQVIN-PQTLSVALSGAVACVTHVDGPNL 202 H G+N E + +KI Q + K +P ++ + P + A + H P Sbjct: 141 HTGFNAVVRREPSAVKIAQPVHKVIAQPVHVSSYAHAPVAHATVQHHHAAPIAHYSAPIA 200 Query: 203 HIA 205 H A Sbjct: 201 HHA 203 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 25.4 bits (53), Expect = 3.1 Identities = 15/63 (23%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 144 HEGYNVPTALEQAIIKIDQDLSKEAVEPYKLNQVIN-PQTLSVALSGAVACVTHVDGPNL 202 H G+N E + +KI Q + K +P ++ + P + A + H P Sbjct: 165 HTGFNAVVRREPSAVKIAQPVHKVIAQPVHVSSYAHAPVAHATVQHHHAAPIAHYSAPIA 224 Query: 203 HIA 205 H A Sbjct: 225 HHA 227 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 25.4 bits (53), Expect = 3.1 Identities = 15/63 (23%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 144 HEGYNVPTALEQAIIKIDQDLSKEAVEPYKLNQVIN-PQTLSVALSGAVACVTHVDGPNL 202 H G+N E + +KI Q + K +P ++ + P + A + H P Sbjct: 133 HTGFNAVVRREPSAVKIAQPVHKVIAQPVHVSSYAHAPVAHATVQHHHAAPIAHYSAPIA 192 Query: 203 HIA 205 H A Sbjct: 193 HHA 195 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 25.4 bits (53), Expect = 3.1 Identities = 15/63 (23%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 144 HEGYNVPTALEQAIIKIDQDLSKEAVEPYKLNQVIN-PQTLSVALSGAVACVTHVDGPNL 202 H G+N E + +KI Q + K +P ++ + P + A + H P Sbjct: 141 HTGFNAVVRREPSAVKIAQPVHKVIAQPVDVSSYAHAPVAHATVQHHHAAPIAHYSAPIA 200 Query: 203 HIA 205 H A Sbjct: 201 HHA 203 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 25.0 bits (52), Expect = 4.1 Identities = 15/63 (23%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 144 HEGYNVPTALEQAIIKIDQDLSKEAVEPYKLNQVIN-PQTLSVALSGAVACVTHVDGPNL 202 H G+N E + +KI Q + K +P ++ + P + A + H P Sbjct: 133 HTGFNAVVRPEPSAVKIAQPVHKVIAQPVHVSSYAHAPVAHATVQHHHAAPIAHYSAPIA 192 Query: 203 HIA 205 H A Sbjct: 193 HHA 195 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 24.6 bits (51), Expect = 5.5 Identities = 9/19 (47%), Positives = 14/19 (73%) Query: 410 LAHLLSLSPDVSRMFRDDI 428 +AH L+++PDV RD+I Sbjct: 341 MAHELAVNPDVQERLRDEI 359 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 24.6 bits (51), Expect = 5.5 Identities = 15/63 (23%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 144 HEGYNVPTALEQAIIKIDQDLSKEAVEPYKLNQVIN-PQTLSVALSGAVACVTHVDGPNL 202 H G+N E + +KI Q + K +P ++ + P + A + H P Sbjct: 141 HTGFNAVVRREPSAVKIAQPVHKVIAQPVHVSSYAHAPVAHATVQHHHAAPIAHYAAPIA 200 Query: 203 HIA 205 H A Sbjct: 201 HHA 203 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 24.6 bits (51), Expect = 5.5 Identities = 15/63 (23%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 144 HEGYNVPTALEQAIIKIDQDLSKEAVEPYKLNQVIN-PQTLSVALSGAVACVTHVDGPNL 202 H G+N E + +KI Q + K +P ++ + P + A + H P Sbjct: 133 HTGFNAVVRREPSAVKIAQPVHKVIAQPVHVSSYAHAPVAHATVQHHHAAPIAHYAAPIA 192 Query: 203 HIA 205 H A Sbjct: 193 HHA 195 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 24.6 bits (51), Expect = 5.5 Identities = 15/63 (23%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 144 HEGYNVPTALEQAIIKIDQDLSKEAVEPYKLNQVIN-PQTLSVALSGAVACVTHVDGPNL 202 H G+N E + +KI Q + K +P ++ + P + A + H P Sbjct: 133 HTGFNAVVRREPSAVKIAQPVHKVIAQPVHVSSYAHAPVAHATVQHHHAAPIAHYAAPIA 192 Query: 203 HIA 205 H A Sbjct: 193 HHA 195 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 24.6 bits (51), Expect = 5.5 Identities = 15/63 (23%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 144 HEGYNVPTALEQAIIKIDQDLSKEAVEPYKLNQVIN-PQTLSVALSGAVACVTHVDGPNL 202 H G+N E + +KI Q + K +P ++ + P + A + H P Sbjct: 133 HTGFNAVVRREPSAVKIAQPVHKVIAQPVHVSSYAHAPVAHATVQHHHAAPIAHYAAPIA 192 Query: 203 HIA 205 H A Sbjct: 193 HHA 195 >CR954257-6|CAJ14157.1| 375|Anopheles gambiae RrnaAD, ribosomal RNA adenine dimethylaseprotein. Length = 375 Score = 24.2 bits (50), Expect = 7.2 Identities = 10/35 (28%), Positives = 19/35 (54%) Query: 411 AHLLSLSPDVSRMFRDDITVTVMYFDSEFLRQCPA 445 +H+ S +++R V +YF+ EFL + P+ Sbjct: 144 SHIASTKDAGYKLYRGGTIVFQLYFEHEFLGKVPS 178 >CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. Length = 376 Score = 24.2 bits (50), Expect = 7.2 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 2/67 (2%) Query: 204 IANVGDCNAVLGILTEDKEWIAK-KITKEHNS-ENFDELKRIWNEHPDNERKTVIRRDRL 261 + +G+ +A +G + K I K EH N+D++++IW+ NE + + Sbjct: 45 MVGMGNKDAYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPV 104 Query: 262 LGELAPL 268 L APL Sbjct: 105 LLTEAPL 111 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 24.2 bits (50), Expect = 7.2 Identities = 15/62 (24%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Query: 144 HEGYNVPTALEQAIIKIDQDLSKEAVEPYKLNQVINPQTLSVALSGAVACVTHVDGPNLH 203 H G+N E + +KI Q + K +P ++ + T+ A + H P H Sbjct: 133 HTGFNAVVRREPSAVKIAQPVHKVIAQPVHVHAPVAHATVQ---HHHAAPIAHYSAPIAH 189 Query: 204 IA 205 A Sbjct: 190 HA 191 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.320 0.137 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 476,036 Number of Sequences: 2123 Number of extensions: 19456 Number of successful extensions: 70 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 12 Number of HSP's that attempted gapping in prelim test: 67 Number of HSP's gapped (non-prelim): 15 length of query: 445 length of database: 516,269 effective HSP length: 66 effective length of query: 379 effective length of database: 376,151 effective search space: 142561229 effective search space used: 142561229 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -