SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000510-TA|BGIBMGA000510-PA|IPR001660|Sterile alpha motif
SAM, IPR010993|Sterile alpha motif homology
         (133 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF457547-1|AAL68777.1|  163|Anopheles gambiae selenoprotein prot...    22   8.0  

>AF457547-1|AAL68777.1|  163|Anopheles gambiae selenoprotein
           protein.
          Length = 163

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 13/49 (26%), Positives = 23/49 (46%)

Query: 81  EFLMQEVDGEALLLIKPEHLVMALSMKLGPALKIVACIDSLRPESEQNL 129
           E   ++ + ++ L + P  ++   + K G   +I A I S RP    NL
Sbjct: 58  ECCQKDTEADSKLKVYPAAVLEVCTCKFGAYPQIQAFIKSDRPAKFPNL 106


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.314    0.129    0.371 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 115,251
Number of Sequences: 2123
Number of extensions: 3552
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 133
length of database: 516,269
effective HSP length: 58
effective length of query: 75
effective length of database: 393,135
effective search space: 29485125
effective search space used: 29485125
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 44 (21.8 bits)

- SilkBase 1999-2023 -