GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000509-TA|BGIBMGA000509-PA|undefined
         (888 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ414247-1|ABD63009.2|  414|Tribolium castaneum paired protein.        26   0.98 
EF117815-1|ABO38438.1|  535|Tribolium castaneum cryptochrome 2 p...    24   5.2  

>DQ414247-1|ABD63009.2|  414|Tribolium castaneum paired protein.
          Length = 414

 Score = 26.2 bits (55), Expect = 0.98
 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 4/31 (12%)

Query: 220 APFPGYTTIPAIPTTQNQTFVFSSNILPAHS 250
           +P PG++T P +P T N     + N  P+HS
Sbjct: 325 SPVPGHSTSPNLPLTHN----IAHNPYPSHS 351


>EF117815-1|ABO38438.1|  535|Tribolium castaneum cryptochrome 2
           protein.
          Length = 535

 Score = 23.8 bits (49), Expect = 5.2
 Identities = 7/9 (77%), Positives = 8/9 (88%)

Query: 734 CMGPPPPPD 742
           CMGPPP P+
Sbjct: 173 CMGPPPQPE 181


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.314    0.128    0.377 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,417
Number of Sequences: 317
Number of extensions: 6046
Number of successful extensions: 15
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 11
Number of HSP's gapped (non-prelim): 4
length of query: 888
length of database: 114,650
effective HSP length: 63
effective length of query: 825
effective length of database: 94,679
effective search space: 78110175
effective search space used: 78110175
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 47 (23.0 bits)