BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000509-TA|BGIBMGA000509-PA|undefined (888 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 27 0.88 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 4.7 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 26.6 bits (56), Expect = 0.88 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 3/33 (9%) Query: 53 SGEIKPQQIVEGQPQVVQHQLSMAQHEPSQQHH 85 S ++PQ +V G PQ Q QL+ A+ + QQH+ Sbjct: 100 SAALQPQHVVYGNPQ--QQQLA-AETQQQQQHN 129 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.2 bits (50), Expect = 4.7 Identities = 11/28 (39%), Positives = 14/28 (50%) Query: 59 QQIVEGQPQVVQHQLSMAQHEPSQQHHQ 86 QQ + QPQ Q Q Q +P QQ + Sbjct: 1522 QQPQQQQPQPQQQQQQQQQQQPQQQQKE 1549 Score = 23.8 bits (49), Expect = 6.2 Identities = 12/48 (25%), Positives = 20/48 (41%) Query: 221 PFPGYTTIPAIPTTQNQTFVFSSNILPAHSQPTVSGITQQQKQSDMHK 268 P P P +PT + + +S I Q + + QQQ+Q + Sbjct: 1171 PSPFMAGAPNVPTILPEQYFATSRIRGLQEQQRNAAMVQQQQQQQQQQ 1218 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.314 0.128 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,185 Number of Sequences: 429 Number of extensions: 7100 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 5 length of query: 888 length of database: 140,377 effective HSP length: 64 effective length of query: 824 effective length of database: 112,921 effective search space: 93046904 effective search space used: 93046904 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -