BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000503-TA|BGIBMGA000503-PA|undefined (587 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 23 7.8 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 22.6 bits (46), Expect = 7.8 Identities = 14/56 (25%), Positives = 26/56 (46%) Query: 424 NLPPQMINEFMTQEKERHRLRIQHLVEKEKLVLAVEQEILRVHGRAERAVANQSLP 479 ++P Q++NEF + L+ Q +E + V ++I + E A+ LP Sbjct: 20 SIPQQILNEFKSTLLPLFGLKEQPKIEGKVQVPEALKKIYNIQNNFEYDTASLPLP 75 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.128 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,735 Number of Sequences: 317 Number of extensions: 4226 Number of successful extensions: 21 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 20 Number of HSP's gapped (non-prelim): 1 length of query: 587 length of database: 114,650 effective HSP length: 61 effective length of query: 526 effective length of database: 95,313 effective search space: 50134638 effective search space used: 50134638 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -