SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000503-TA|BGIBMGA000503-PA|undefined
         (587 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U63132-1|AAB38392.1|  372|Tribolium castaneum decapentaplegic pr...    23   7.8  

>U63132-1|AAB38392.1|  372|Tribolium castaneum decapentaplegic
           protein protein.
          Length = 372

 Score = 22.6 bits (46), Expect = 7.8
 Identities = 14/56 (25%), Positives = 26/56 (46%)

Query: 424 NLPPQMINEFMTQEKERHRLRIQHLVEKEKLVLAVEQEILRVHGRAERAVANQSLP 479
           ++P Q++NEF +       L+ Q  +E +  V    ++I  +    E   A+  LP
Sbjct: 20  SIPQQILNEFKSTLLPLFGLKEQPKIEGKVQVPEALKKIYNIQNNFEYDTASLPLP 75


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.313    0.128    0.380 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 109,735
Number of Sequences: 317
Number of extensions: 4226
Number of successful extensions: 21
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 20
Number of HSP's gapped (non-prelim): 1
length of query: 587
length of database: 114,650
effective HSP length: 61
effective length of query: 526
effective length of database: 95,313
effective search space: 50134638
effective search space used: 50134638
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 46 (22.6 bits)

- SilkBase 1999-2023 -