BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000503-TA|BGIBMGA000503-PA|undefined
(587 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 23 7.8
>U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic
protein protein.
Length = 372
Score = 22.6 bits (46), Expect = 7.8
Identities = 14/56 (25%), Positives = 26/56 (46%)
Query: 424 NLPPQMINEFMTQEKERHRLRIQHLVEKEKLVLAVEQEILRVHGRAERAVANQSLP 479
++P Q++NEF + L+ Q +E + V ++I + E A+ LP
Sbjct: 20 SIPQQILNEFKSTLLPLFGLKEQPKIEGKVQVPEALKKIYNIQNNFEYDTASLPLP 75
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.313 0.128 0.380
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 109,735
Number of Sequences: 317
Number of extensions: 4226
Number of successful extensions: 21
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 20
Number of HSP's gapped (non-prelim): 1
length of query: 587
length of database: 114,650
effective HSP length: 61
effective length of query: 526
effective length of database: 95,313
effective search space: 50134638
effective search space used: 50134638
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 46 (22.6 bits)
- SilkBase 1999-2023 -