BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000502-TA|BGIBMGA000502-PA|IPR002110|Ankyrin (187 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 6.2 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 6.2 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.2 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 5/31 (16%) Query: 156 DPFVKNSKGKMPSDYAAPHIYEYLQSLKGML 186 D F++ S+ D PH+ EY++SL ++ Sbjct: 44 DAFIRTSE-----DDNDPHVNEYVESLASII 69 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 5/31 (16%) Query: 156 DPFVKNSKGKMPSDYAAPHIYEYLQSLKGML 186 D F++ S+ D PH+ EY++SL ++ Sbjct: 358 DAFIRTSE-----DDNDPHVNEYVESLASII 383 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 5/31 (16%) Query: 156 DPFVKNSKGKMPSDYAAPHIYEYLQSLKGML 186 D F++ S+ D PH+ EY++SL ++ Sbjct: 591 DAFIRTSE-----DDNDPHVNEYVESLASII 616 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 5/31 (16%) Query: 156 DPFVKNSKGKMPSDYAAPHIYEYLQSLKGML 186 D F++ S+ D PH+ EY++SL ++ Sbjct: 591 DAFIRTSE-----DDNDPHVNEYVESLASII 616 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.133 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,782 Number of Sequences: 317 Number of extensions: 1307 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 187 length of database: 114,650 effective HSP length: 53 effective length of query: 134 effective length of database: 97,849 effective search space: 13111766 effective search space used: 13111766 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -