BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000500-TA|BGIBMGA000500-PA|IPR000859|CUB (382 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0461 - 4063614-4064375,4064439-4066017,4066041-4066086,406... 29 4.7 01_06_0653 + 30891231-30891276,30891624-30892898,30893775-30893878 29 8.2 >08_01_0461 - 4063614-4064375,4064439-4066017,4066041-4066086, 4066416-4066933,4067435-4067694,4068089-4068594, 4068667-4071319 Length = 2107 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Query: 17 TANTIYNTHDSVADEFDNDLDHHEEREGRIFSRTCGS 53 TANT+ + D + FD ++D+H E + I C S Sbjct: 1924 TANTLNSRGDLIRQIFDKEIDNHHEEKLLICQICCSS 1960 >01_06_0653 + 30891231-30891276,30891624-30892898,30893775-30893878 Length = 474 Score = 28.7 bits (61), Expect = 8.2 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 4/64 (6%) Query: 171 DCPGLAPNG-CLQYYTGITDT---INSFNYGTGANTLLSASLVTGTRQIANLNYGICIRM 226 DC + P+ C Q T + NS+ GAN + TG R + +Y C+ M Sbjct: 389 DCSAIQPSQPCYQPDTLASHASYAFNSYYQQNGANDVACDFGGTGVRTTKDPSYDTCVYM 448 Query: 227 EAGY 230 AGY Sbjct: 449 AAGY 452 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.321 0.137 0.427 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,195,962 Number of Sequences: 37544 Number of extensions: 375061 Number of successful extensions: 678 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 677 Number of HSP's gapped (non-prelim): 2 length of query: 382 length of database: 14,793,348 effective HSP length: 83 effective length of query: 299 effective length of database: 11,677,196 effective search space: 3491481604 effective search space used: 3491481604 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -