BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000500-TA|BGIBMGA000500-PA|IPR000859|CUB (382 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 25 4.6 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 24 6.1 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 24.6 bits (51), Expect = 4.6 Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 301 VPVQKCAIN-WPEGMIPEAINTVQERLELSNTEDVE 335 V + +C+++ WP P I ++ RLE + E +E Sbjct: 77 VQIPECSVDDWPRAPNPREIIDLEARLEKTENEILE 112 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 24.2 bits (50), Expect = 6.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Query: 85 NNNICQLRIDFLDFVIAQPDGDGVCVTDSI 114 + N +L + FL + PD DG+ +DS+ Sbjct: 276 DKNNPRLALIFLGYTTPPPDSDGIKYSDSL 305 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.321 0.137 0.427 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 377,081 Number of Sequences: 2123 Number of extensions: 13376 Number of successful extensions: 59 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 58 Number of HSP's gapped (non-prelim): 2 length of query: 382 length of database: 516,269 effective HSP length: 65 effective length of query: 317 effective length of database: 378,274 effective search space: 119912858 effective search space used: 119912858 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -