SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000499-TA|BGIBMGA000499-PA|undefined
         (265 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC3H1.14 ||SPAC9G1.01|cytoplasmic vesicle protein, Vid24 famil...    25   8.5  

>SPAC3H1.14 ||SPAC9G1.01|cytoplasmic vesicle protein, Vid24
           family|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 195

 Score = 25.4 bits (53), Expect = 8.5
 Identities = 17/72 (23%), Positives = 35/72 (48%), Gaps = 7/72 (9%)

Query: 15  QVNNRKTSELESLLCKQEGASLAPAHMDLFDGGTSSRDDAFLRPALWEDIASSIRNIDPE 74
           +++NR    L +L  K  G  +    +  +D    SR+  ++R   W+++A   + +D +
Sbjct: 84  EIDNRHWKRLGAL--KSNGKDIPLRLIQPYD--PLSRETVYMR---WKELAMLDKTVDYQ 136

Query: 75  NANMLAPLGATH 86
           N N   P G ++
Sbjct: 137 NHNQSFPFGISY 148


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.315    0.132    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 998,096
Number of Sequences: 5004
Number of extensions: 30543
Number of successful extensions: 51
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 51
Number of HSP's gapped (non-prelim): 1
length of query: 265
length of database: 2,362,478
effective HSP length: 71
effective length of query: 194
effective length of database: 2,007,194
effective search space: 389395636
effective search space used: 389395636
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 53 (25.4 bits)

- SilkBase 1999-2023 -