BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000499-TA|BGIBMGA000499-PA|undefined (265 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H1.14 ||SPAC9G1.01|cytoplasmic vesicle protein, Vid24 famil... 25 8.5 >SPAC3H1.14 ||SPAC9G1.01|cytoplasmic vesicle protein, Vid24 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 195 Score = 25.4 bits (53), Expect = 8.5 Identities = 17/72 (23%), Positives = 35/72 (48%), Gaps = 7/72 (9%) Query: 15 QVNNRKTSELESLLCKQEGASLAPAHMDLFDGGTSSRDDAFLRPALWEDIASSIRNIDPE 74 +++NR L +L K G + + +D SR+ ++R W+++A + +D + Sbjct: 84 EIDNRHWKRLGAL--KSNGKDIPLRLIQPYD--PLSRETVYMR---WKELAMLDKTVDYQ 136 Query: 75 NANMLAPLGATH 86 N N P G ++ Sbjct: 137 NHNQSFPFGISY 148 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.315 0.132 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 998,096 Number of Sequences: 5004 Number of extensions: 30543 Number of successful extensions: 51 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 51 Number of HSP's gapped (non-prelim): 1 length of query: 265 length of database: 2,362,478 effective HSP length: 71 effective length of query: 194 effective length of database: 2,007,194 effective search space: 389395636 effective search space used: 389395636 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -