BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000499-TA|BGIBMGA000499-PA|undefined (265 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 >SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3669 Score = 29.1 bits (62), Expect = 3.9 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 1/77 (1%) Query: 6 ESNAPPSTVQVNNRKTSELESLLCKQEGASLAPAHMDLFDGGTSSRDDAFLRPALWEDIA 65 E + PS + +N R+ S+ S L +Q+G + P + LF G + + A ED Sbjct: 2173 ERRSLPSRLVINKRRFSKKNSRLARQQGGNRTPRRL-LFPKGALLKPERRRLSAGTEDAL 2231 Query: 66 SSIRNIDPENANMLAPL 82 ++ + A PL Sbjct: 2232 VAVTRCAEDAATPAHPL 2248 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 28.3 bits (60), Expect = 6.9 Identities = 13/45 (28%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Query: 11 PSTVQVNNRKTSELESLLC--KQEGASLAPAHMDLFDGGTSSRDD 53 P+ V V ++L++LL ++EG ++ P+H + + G++S D Sbjct: 4404 PNVVHVGKDHETDLDNLLSHLEEEGVAIHPSHQGVVEKGSASPRD 4448 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.132 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,744,762 Number of Sequences: 59808 Number of extensions: 248644 Number of successful extensions: 451 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 451 Number of HSP's gapped (non-prelim): 2 length of query: 265 length of database: 16,821,457 effective HSP length: 81 effective length of query: 184 effective length of database: 11,977,009 effective search space: 2203769656 effective search space used: 2203769656 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -