BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000497-TA|BGIBMGA000497-PA|IPR011598|Helix-loop-helix DNA-binding, IPR001092|Basic helix-loop-helix dimerisation region bHLH (233 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 37 1e-04 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 27 0.20 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 23 2.4 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 2.4 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 2.4 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 3.2 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 9.7 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 37.1 bits (82), Expect = 1e-04 Identities = 26/67 (38%), Positives = 33/67 (49%), Gaps = 7/67 (10%) Query: 105 QRAAANVRERRRMLRSGPNCSINSAFDELRVHVPTFPYEKRLSKIDTXXXXXXXXXXXXE 164 QR ANVRER+R S+N AF LR +PT P +K LSKI T + Sbjct: 254 QRVMANVRERQRTQ------SLNEAFAALRKIIPTLPSDK-LSKIQTLKLATRYIDFLFQ 306 Query: 165 VLDADYD 171 VL + + Sbjct: 307 VLHCNME 313 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 26.6 bits (56), Expect = 0.20 Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 191 WNTSDLTARLSWINWENLGVNP 212 W + A ++W+ W N G+NP Sbjct: 366 WQEKIVFAAVTWLGWINSGMNP 387 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 23.0 bits (47), Expect = 2.4 Identities = 7/17 (41%), Positives = 10/17 (58%) Query: 196 LTARLSWINWENLGVNP 212 L L+W+ W N +NP Sbjct: 340 LMPALTWLGWINSAINP 356 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 7 QLADSSTSPPLSDSRRLDY 25 Q++ +ST+ LSD R DY Sbjct: 96 QISPASTAKALSDKTRFDY 114 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 7 QLADSSTSPPLSDSRRLDY 25 Q++ +ST+ LSD R DY Sbjct: 186 QISPASTAKALSDKTRFDY 204 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/35 (28%), Positives = 18/35 (51%) Query: 174 TYVEKCLRGEIKADRAHWNTSDLTARLSWINWENL 208 T + +R ++ + W+ SD +ARL W N+ Sbjct: 556 TLIYPIIRRKLGSALGGWHPSDRSARLMLQPWANV 590 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Query: 25 YSGLKFSYVDGSDDESASLHSELPS 49 Y GL S+V G ++ H E PS Sbjct: 182 YFGLAISFVFGMKEKRKEHHLEGPS 206 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.130 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,607 Number of Sequences: 429 Number of extensions: 2148 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 7 length of query: 233 length of database: 140,377 effective HSP length: 56 effective length of query: 177 effective length of database: 116,353 effective search space: 20594481 effective search space used: 20594481 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -