BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000495-TA|BGIBMGA000495-PA|undefined (70 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35282| Best HMM Match : HEAT (HMM E-Value=4.1) 27 2.8 SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) 25 6.4 >SB_35282| Best HMM Match : HEAT (HMM E-Value=4.1) Length = 232 Score = 26.6 bits (56), Expect = 2.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Query: 7 RPYFILIRKEEEKGDRFARINMEVKHQAID 36 RPYF+ +++ E +G FAR V + D Sbjct: 203 RPYFLRLQEYEREGPFFARAEAAVAFEGAD 232 >SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) Length = 629 Score = 25.4 bits (53), Expect = 6.4 Identities = 10/36 (27%), Positives = 15/36 (41%) Query: 35 IDEQINPFTKKTVYTQTYPTKLIPAAPRKACCFYCS 70 +DEQ P + K + RK CC +C+ Sbjct: 544 VDEQCKPLNALNASQVRFVIKKLTKMIRKYCCMHCN 579 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.323 0.137 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,497,109 Number of Sequences: 59808 Number of extensions: 78485 Number of successful extensions: 194 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 192 Number of HSP's gapped (non-prelim): 2 length of query: 70 length of database: 16,821,457 effective HSP length: 49 effective length of query: 21 effective length of database: 13,890,865 effective search space: 291708165 effective search space used: 291708165 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -