BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000495-TA|BGIBMGA000495-PA|undefined (70 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 23 1.4 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 23 1.4 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 23 1.4 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 23 1.4 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 23 1.4 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 23 1.4 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 23 1.4 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 23 1.4 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 23 1.4 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 23 1.4 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 23 1.4 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 23 1.4 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 23 1.4 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 23 1.4 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 23 1.4 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 23 1.4 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 23 1.4 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 23 1.4 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 1.4 AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 21 4.3 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 21 5.7 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 20 7.5 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 20 7.5 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 20 7.5 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 20 7.5 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 20 7.5 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 20 7.5 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 20 7.5 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 20 7.5 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 20 7.5 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 20 7.5 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 20 7.5 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 20 7.5 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 20 7.5 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 20 7.5 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 20 7.5 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 20 7.5 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 20 7.5 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 20 7.5 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 20 7.5 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 20 7.5 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 20 7.5 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 20 7.5 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 20 7.5 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 20 7.5 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 20 7.5 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 20 7.5 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 20 7.5 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 20 7.5 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 20 9.9 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 368 AKITLEQKKKALDEQVS 384 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Query: 24 ARINMEVKHQAIDEQIN 40 A+I +E K +A+DEQ++ Sbjct: 383 AKITLEQKKKALDEQVS 399 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 22.6 bits (46), Expect = 1.4 Identities = 7/16 (43%), Positives = 13/16 (81%) Query: 45 KTVYTQTYPTKLIPAA 60 +T+YT +PT L+P++ Sbjct: 514 RTLYTAHFPTHLLPSS 529 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 21.0 bits (42), Expect = 4.3 Identities = 7/16 (43%), Positives = 12/16 (75%) Query: 5 DFRPYFILIRKEEEKG 20 +F P F ++KE+E+G Sbjct: 67 EFLPIFSQVKKEKEQG 82 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 20.6 bits (41), Expect = 5.7 Identities = 11/32 (34%), Positives = 13/32 (40%) Query: 4 NDFRPYFILIRKEEEKGDRFARINMEVKHQAI 35 N YFIL + RIN HQA+ Sbjct: 254 NKLAMYFILPNPDNTVNQVLDRINSASLHQAL 285 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 65 DQDISLYHRLSITTKYYETNIVP 87 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 65 DQDISLYHRLSITTKYYETNIVP 87 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 65 DQDISLYHRLSITTKYYETNIVP 87 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 65 DQDISLYHRLSITTKYYETNIVP 87 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 65 DQDISLYHRLSITTKYYETNIVP 87 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 65 DQDISLYHRLSITTKYYETNIVP 87 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 50 DQDISLYHRLSITTKYYETNIVP 72 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 50 DQDISLYHRLSITTKYYETNIVP 72 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 52 DQDISLYHRLSITTKYYETNIVP 74 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 52 DQDISLYHRLSITTKYYETNIVP 74 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 55 DQDISLYHRLSITTKYYETNIVP 77 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 55 DQDISLYHRLSITTKYYETNIVP 77 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 65 DQDISLYHRLSITTKYYETNIVP 87 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 65 DQDISLYHRLSITTKYYETNIVP 87 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 65 DQDISLYHRLSITTKYYETNIVP 87 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 65 DQDISLYHRLSITTKYYETNIVP 87 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 65 DQDISLYHRLSITTKYYETNIVP 87 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 65 DQDISLYHRLSITTKYYETNIVP 87 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 67 DQDISLYHRLSITTKYYETNIVP 89 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 67 DQDISLYHRLSITTKYYETNIVP 89 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 49 DQDISLYHRLSITTKYYETNIVP 71 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 49 DQDISLYHRLSITTKYYETNIVP 71 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 20.2 bits (40), Expect = 7.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Query: 36 DEQINPFTKKTVYTQTYPTKLIP 58 D+ I+ + + ++ T+ Y T ++P Sbjct: 64 DQDISLYHRLSITTKYYETNIVP 86 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 20.2 bits (40), Expect = 7.5 Identities = 8/12 (66%), Positives = 9/12 (75%) Query: 17 EEKGDRFARINM 28 E KGDR ARI + Sbjct: 596 EGKGDRLARIEL 607 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 19.8 bits (39), Expect = 9.9 Identities = 8/20 (40%), Positives = 11/20 (55%) Query: 39 INPFTKKTVYTQTYPTKLIP 58 INP+ K V + P L+P Sbjct: 136 INPYHYKRVESPVLPPVLVP 155 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.323 0.137 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,070 Number of Sequences: 2123 Number of extensions: 2496 Number of successful extensions: 92 Number of sequences better than 10.0: 92 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of query: 70 length of database: 516,269 effective HSP length: 48 effective length of query: 22 effective length of database: 414,365 effective search space: 9116030 effective search space used: 9116030 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (21.1 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -