BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000494-TA|BGIBMGA000494-PA|undefined (1054 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 30 0.072 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 8.3 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 30.3 bits (65), Expect = 0.072 Identities = 18/65 (27%), Positives = 30/65 (46%) Query: 410 QREFNFIDSFFESLQYLENCSLSNKCLSTNKVENLIKNPILYDSDFDIKATEYLELLPKF 469 +RE+ + + + + L +C L K S+N+ PILYD D+ ++ LP Sbjct: 153 KREYYWPNMYRTIKKRLRSCDLCQKTKSSNRPHQGPLTPILYDHIGDLVCVDFYGPLPTG 212 Query: 470 ENGTS 474 G S Sbjct: 213 RLGAS 217 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.4 bits (48), Expect = 8.3 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 525 LENKKKHENTDVSTLKKKQRGAL-LKLQH 552 L+N + H D TL + RGA LKLQ+ Sbjct: 590 LKNLEIHVTKDTDTLDNEMRGAWPLKLQN 618 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.129 0.363 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 225,302 Number of Sequences: 317 Number of extensions: 9165 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 23 Number of HSP's gapped (non-prelim): 2 length of query: 1054 length of database: 114,650 effective HSP length: 64 effective length of query: 990 effective length of database: 94,362 effective search space: 93418380 effective search space used: 93418380 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -