BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000493-TA|BGIBMGA000493-PA|undefined (201 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 25 0.37 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 25 0.49 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 24 1.1 EF013227-1|ABK54581.1| 119|Apis mellifera elongation factor 1-a... 24 1.1 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 8.1 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 8.1 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 8.1 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 8.1 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 8.1 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 8.1 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 25.4 bits (53), Expect = 0.37 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 100 LESAVP-ETEGFGSKTLSVKENIQNVVAGIFQPKP 133 L+ AVP + GF K +SVKE + VAG + P Sbjct: 299 LQEAVPGDNVGFNVKNVSVKELRRGYVAGDSKNNP 333 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 25.0 bits (52), Expect = 0.49 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Query: 100 LESAVP-ETEGFGSKTLSVKENIQNVVAG 127 L+ AVP + GF K +SVKE + VAG Sbjct: 242 LQEAVPGDNVGFNVKNVSVKELRRGYVAG 270 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 23.8 bits (49), Expect = 1.1 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 100 LESAVP-ETEGFGSKTLSVKENIQNVVAGIFQPKP 133 L A+P + GF K +SVKE + VAG + +P Sbjct: 299 LTEALPGDNVGFNVKNISVKELRRGYVAGDSKNQP 333 >EF013227-1|ABK54581.1| 119|Apis mellifera elongation factor 1-alpha protein. Length = 119 Score = 23.8 bits (49), Expect = 1.1 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 100 LESAVP-ETEGFGSKTLSVKENIQNVVAGIFQPKP 133 L A+P + GF K +SVKE + VAG + +P Sbjct: 10 LTEALPGDNVGFNVKNISVKELRRGYVAGDSKNQP 44 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.0 bits (42), Expect = 8.1 Identities = 10/31 (32%), Positives = 15/31 (48%) Query: 111 GSKTLSVKENIQNVVAGIFQPKPIVDTISES 141 G K Q VVA + P+P V T++ + Sbjct: 161 GDKPPLTYHQFQTVVASMDPPEPPVPTVTSA 191 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 8.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 109 GFGSKTLSVKENIQNVVAGI 128 G GSK L +E I+NV+ I Sbjct: 167 GEGSKPLFEREEIKNVLTKI 186 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 8.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 109 GFGSKTLSVKENIQNVVAGI 128 G GSK L +E I+NV+ I Sbjct: 156 GEGSKPLFEREEIKNVLTKI 175 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 8.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 109 GFGSKTLSVKENIQNVVAGI 128 G GSK L +E I+NV+ I Sbjct: 167 GEGSKPLFEREEIKNVLTKI 186 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 8.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 109 GFGSKTLSVKENIQNVVAGI 128 G GSK L +E I+NV+ I Sbjct: 167 GEGSKPLFEREEIKNVLTKI 186 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 8.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 109 GFGSKTLSVKENIQNVVAGI 128 G GSK L +E I+NV+ I Sbjct: 156 GEGSKPLFEREEIKNVLTKI 175 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.311 0.130 0.358 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,147 Number of Sequences: 429 Number of extensions: 2072 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 201 length of database: 140,377 effective HSP length: 55 effective length of query: 146 effective length of database: 116,782 effective search space: 17050172 effective search space used: 17050172 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -