BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000493-TA|BGIBMGA000493-PA|undefined (201 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 1.3 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 1.3 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 3.9 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 21 9.0 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 9.0 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 23.4 bits (48), Expect = 1.3 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Query: 77 SNKIETQVKALNFGGPFASRTSTLESAVPETEGFGSKTLSVKENI 121 SN + ++ +N G P +S+T +SA + + TL+VKE++ Sbjct: 130 SNLTVSGLRCVN-GIPVSSKTLASQSAYVQQDDLFIGTLTVKEHL 173 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 23.4 bits (48), Expect = 1.3 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Query: 77 SNKIETQVKALNFGGPFASRTSTLESAVPETEGFGSKTLSVKENI 121 SN + ++ +N G P +S+T +SA + + TL+VKE++ Sbjct: 130 SNLTVSGLRCVN-GIPVSSKTLASQSAYVQQDDLFIGTLTVKEHL 173 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 3.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Query: 45 TVIEAENYPGGEP 57 T+I AE PGG P Sbjct: 987 TIITAEEVPGGPP 999 Score = 21.4 bits (43), Expect = 5.1 Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 79 KIETQVKALNFGGP 92 KIE QV+ ++FG P Sbjct: 331 KIEPQVQTIDFGRP 344 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 20.6 bits (41), Expect = 9.0 Identities = 8/19 (42%), Positives = 10/19 (52%) Query: 41 IQPNTVIEAENYPGGEPDT 59 I P T +EA P P+T Sbjct: 28 ILPETALEAPKSPENHPET 46 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 20.6 bits (41), Expect = 9.0 Identities = 6/37 (16%), Positives = 21/37 (56%) Query: 11 LCVSISTSAPADSPIRVDLPVFDQPQTNFDIQPNTVI 47 +C++++ + P + + +++ P+ N + PN ++ Sbjct: 137 VCLAMTITGPLVIIGNIAMELWNMPRENIEPLPNVIL 173 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.311 0.130 0.358 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,434 Number of Sequences: 317 Number of extensions: 1912 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 201 length of database: 114,650 effective HSP length: 54 effective length of query: 147 effective length of database: 97,532 effective search space: 14337204 effective search space used: 14337204 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.4 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -