BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000493-TA|BGIBMGA000493-PA|undefined (201 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK096693-1|BAC04844.1| 213|Homo sapiens protein ( Homo sapiens ... 30 6.3 >AK096693-1|BAC04844.1| 213|Homo sapiens protein ( Homo sapiens cDNA FLJ39374 fis, clone PEBLM2008576, highly similar to Homo sapiens mRNA for TOLLIP protein. ). Length = 213 Score = 29.9 bits (64), Expect = 6.3 Identities = 16/44 (36%), Positives = 22/44 (50%) Query: 137 TISESEKYGNTGDKFYSAGKVIVGGAEGVSNVVNSVLEIPGTFI 180 TI ES + G DK+YS G EG+ N+V S +P + Sbjct: 76 TIPESLRQGKVEDKWYSLSGRQGGDKEGMINLVMSYALLPAAMV 119 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.311 0.130 0.358 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,672,623 Number of Sequences: 224733 Number of extensions: 1090446 Number of successful extensions: 1811 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1810 Number of HSP's gapped (non-prelim): 1 length of query: 201 length of database: 73,234,838 effective HSP length: 86 effective length of query: 115 effective length of database: 53,907,800 effective search space: 6199397000 effective search space used: 6199397000 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 63 (29.5 bits)
- SilkBase 1999-2023 -