GeneModel BLAST Result against human

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000493-TA|BGIBMGA000493-PA|undefined
         (201 letters)

Database: human 
           224,733 sequences; 73,234,838 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK096693-1|BAC04844.1|  213|Homo sapiens protein ( Homo sapiens ...    30   6.3  

>AK096693-1|BAC04844.1|  213|Homo sapiens protein ( Homo sapiens
           cDNA FLJ39374 fis, clone PEBLM2008576, highly similar to
           Homo sapiens mRNA for TOLLIP protein. ).
          Length = 213

 Score = 29.9 bits (64), Expect = 6.3
 Identities = 16/44 (36%), Positives = 22/44 (50%)

Query: 137 TISESEKYGNTGDKFYSAGKVIVGGAEGVSNVVNSVLEIPGTFI 180
           TI ES + G   DK+YS      G  EG+ N+V S   +P   +
Sbjct: 76  TIPESLRQGKVEDKWYSLSGRQGGDKEGMINLVMSYALLPAAMV 119


  Database: human
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 73,234,838
  Number of sequences in database:  224,733
  
Lambda     K      H
   0.311    0.130    0.358 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,672,623
Number of Sequences: 224733
Number of extensions: 1090446
Number of successful extensions: 1811
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1810
Number of HSP's gapped (non-prelim): 1
length of query: 201
length of database: 73,234,838
effective HSP length: 86
effective length of query: 115
effective length of database: 53,907,800
effective search space: 6199397000
effective search space used: 6199397000
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 63 (29.5 bits)