BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000492-TA|BGIBMGA000492-PA|IPR001245|Tyrosine protein kinase, IPR011009|Protein kinase-like, IPR000719|Protein kinase (153 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 44 4e-07 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 1.2 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 44.4 bits (100), Expect = 4e-07 Identities = 36/134 (26%), Positives = 53/134 (39%), Gaps = 5/134 (3%) Query: 8 RNVTVSEELNVKVSDYAMFCEEFVGDYHVMADGTRIPLRWMAWEWYVLSSQRCMVIRSYC 67 RNV V E VKVSD+ + + + + + G ++P+RWMA E L+ QR Sbjct: 621 RNVLVCENHTVKVSDFGLSRDVYQDNVYCKNGGGKLPVRWMALE--SLTHQRYTTYSDVW 678 Query: 68 LGGPHYCTVRPFEEMNDDQVVGNASEWRCGGRNXXXXXXXXXXXXXELYDLMHECWRREP 127 G + + VG S +LY +M CW+ P Sbjct: 679 SFG---VLLWEIVTLGGTPYVGVHSSELLDFLKSGNRLARPANCSPDLYAVMLNCWKECP 735 Query: 128 IQRPRFHDLHRFLE 141 RP F +L + LE Sbjct: 736 KNRPTFTELSKSLE 749 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 23.0 bits (47), Expect = 1.2 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 5 RFYRNVTVSEELNVKVSDY-AMFCEEFVGDYHVMADGTRIPLRWMAWEWYVLSS 57 +F N +++ V + Y AM C + D +MA T + + W VLSS Sbjct: 450 KFEFNTVFNDQRTVFANFYDAMICVAYKFDAAMMALRTSFLVNDFGFIWLVLSS 503 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.326 0.140 0.485 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,547 Number of Sequences: 317 Number of extensions: 1347 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 153 length of database: 114,650 effective HSP length: 52 effective length of query: 101 effective length of database: 98,166 effective search space: 9914766 effective search space used: 9914766 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -