BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000491-TA|BGIBMGA000491-PA|IPR008979|Galactose-binding like, IPR000421|Coagulation factor 5/8 type, C-terminal (428 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53762| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 8e-09 SB_57625| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_28427| Best HMM Match : fn3 (HMM E-Value=1.3e-07) 42 0.001 SB_51328| Best HMM Match : F5_F8_type_C (HMM E-Value=8.7e-33) 42 0.001 SB_25734| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_55360| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_41161| Best HMM Match : TSP_1 (HMM E-Value=6e-22) 40 0.004 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 40 0.005 SB_40430| Best HMM Match : F5_F8_type_C (HMM E-Value=1.6e-19) 39 0.009 SB_47160| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.009 SB_41915| Best HMM Match : F5_F8_type_C (HMM E-Value=9.1e-13) 39 0.009 SB_20601| Best HMM Match : F5_F8_type_C (HMM E-Value=9.5e-24) 39 0.009 SB_15475| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 39 0.009 SB_42690| Best HMM Match : F5_F8_type_C (HMM E-Value=7.49695e-43) 38 0.012 SB_55359| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_1173| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_40575| Best HMM Match : F5_F8_type_C (HMM E-Value=1.7e-25) 38 0.021 SB_38824| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 38 0.021 SB_1519| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 37 0.036 SB_56863| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 36 0.048 SB_22736| Best HMM Match : F5_F8_type_C (HMM E-Value=6.4e-24) 36 0.048 SB_22289| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_24622| Best HMM Match : F5_F8_type_C (HMM E-Value=7.4e-17) 36 0.063 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 36 0.063 SB_11950| Best HMM Match : Pentaxin (HMM E-Value=0.12) 36 0.063 SB_11891| Best HMM Match : F5_F8_type_C (HMM E-Value=4.7e-35) 36 0.063 SB_1520| Best HMM Match : F5_F8_type_C (HMM E-Value=1.4e-19) 36 0.063 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.083 SB_27203| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 36 0.083 SB_505| Best HMM Match : F5_F8_type_C (HMM E-Value=4.80645e-43) 36 0.083 SB_48166| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_29271| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 35 0.11 SB_7856| Best HMM Match : F5_F8_type_C (HMM E-Value=3.6e-11) 35 0.11 SB_48467| Best HMM Match : F5_F8_type_C (HMM E-Value=1.4e-21) 35 0.11 SB_20185| Best HMM Match : F5_F8_type_C (HMM E-Value=1.3e-23) 35 0.11 SB_11594| Best HMM Match : F5_F8_type_C (HMM E-Value=4.4e-35) 35 0.11 SB_22840| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 35 0.15 SB_57522| Best HMM Match : F5_F8_type_C (HMM E-Value=0.004) 34 0.19 SB_46586| Best HMM Match : F5_F8_type_C (HMM E-Value=2.7e-15) 34 0.19 SB_58926| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.25 SB_56972| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.25 SB_56512| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 34 0.25 SB_10333| Best HMM Match : ATP1G1_PLM_MAT8 (HMM E-Value=0.73) 34 0.25 SB_51551| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.25 SB_51486| Best HMM Match : F5_F8_type_C (HMM E-Value=3.3e-22) 33 0.34 SB_49607| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_39853| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 33 0.34 SB_37238| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 33 0.34 SB_19278| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 33 0.34 SB_4535| Best HMM Match : F5_F8_type_C (HMM E-Value=3.92364e-44) 33 0.34 SB_20001| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_18969| Best HMM Match : F5_F8_type_C (HMM E-Value=8.4e-38) 33 0.34 SB_5362| Best HMM Match : F5_F8_type_C (HMM E-Value=8.4e-38) 33 0.34 SB_19041| Best HMM Match : F5_F8_type_C (HMM E-Value=3e-29) 33 0.44 SB_23467| Best HMM Match : F5_F8_type_C (HMM E-Value=1.3e-19) 33 0.59 SB_13998| Best HMM Match : Kringle (HMM E-Value=0.0016) 33 0.59 SB_52098| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 33 0.59 SB_2124| Best HMM Match : F5_F8_type_C (HMM E-Value=0.0055) 33 0.59 SB_48144| Best HMM Match : F5_F8_type_C (HMM E-Value=2e-19) 32 0.78 SB_24688| Best HMM Match : F5_F8_type_C (HMM E-Value=4.6e-14) 32 0.78 SB_39600| Best HMM Match : Sushi (HMM E-Value=0) 32 0.78 SB_51087| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.0 SB_42106| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 32 1.0 SB_25944| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 32 1.0 SB_57638| Best HMM Match : F5_F8_type_C (HMM E-Value=1.7e-11) 32 1.0 SB_43390| Best HMM Match : fn3 (HMM E-Value=9.3e-30) 32 1.0 SB_35329| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 32 1.0 SB_25079| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_14824| Best HMM Match : F5_F8_type_C (HMM E-Value=1.5e-17) 31 1.4 SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_36175| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 31 1.4 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 31 1.8 SB_30199| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 31 1.8 SB_18091| Best HMM Match : F5_F8_type_C (HMM E-Value=3.8) 31 1.8 SB_50624| Best HMM Match : F5_F8_type_C (HMM E-Value=6e-10) 31 1.8 SB_22679| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 31 1.8 SB_22331| Best HMM Match : fn3 (HMM E-Value=7.1e-14) 31 1.8 SB_7978| Best HMM Match : F5_F8_type_C (HMM E-Value=1.2e-22) 31 1.8 SB_47631| Best HMM Match : Amb_V_allergen (HMM E-Value=1.4) 31 2.4 SB_13905| Best HMM Match : F5_F8_type_C (HMM E-Value=4.7e-17) 31 2.4 SB_12764| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_13365| Best HMM Match : PKD_channel (HMM E-Value=1.4e-25) 30 3.1 SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_37561| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_59547| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.1 SB_6818| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.1 SB_45697| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.1 SB_7512| Best HMM Match : F5_F8_type_C (HMM E-Value=4.5e-30) 30 4.1 SB_48170| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_45521| Best HMM Match : F5_F8_type_C (HMM E-Value=8.6e-23) 29 5.5 SB_6072| Best HMM Match : F5_F8_type_C (HMM E-Value=1.3e-13) 29 5.5 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 29 5.5 SB_23838| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_16758| Best HMM Match : EGF_CA (HMM E-Value=5.5e-14) 29 5.5 SB_9147| Best HMM Match : Sushi (HMM E-Value=0) 29 5.5 SB_34975| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 7.2 SB_29404| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_9539| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 29 7.2 SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_45866| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 9.6 SB_53452| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.6 SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.6 SB_19731| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.6 SB_11784| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.6 SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.6 >SB_53762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 58.8 bits (136), Expect = 8e-09 Identities = 35/125 (28%), Positives = 57/125 (45%), Gaps = 9/125 (7%) Query: 4 KTLLPYEKFTNRKLNFHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMR 63 + L+ Y +R + GN ++ L +P IA VR + H C++ Sbjct: 692 RDLVLYNNIPSRNTSHFFQLFSTGNHTD--VERHDLLSPHIARYVRFVAHEGHGSMWCLK 749 Query: 64 VELYGCRW--KQALIAYSAPKGGDMQSMTGGAKFEDMSYDGI-----LRKGVMIDGMGQI 116 VELYGC W + L++Y +G TG D+ YDG ++GV+ G+GQ+ Sbjct: 750 VELYGCPWTDQDGLVSYRVSQGNGRSDGTGLGDLRDVGYDGRRLAYGTKRGVLSGGLGQL 809 Query: 117 TDSLL 121 D ++ Sbjct: 810 VDGVV 814 Score = 34.3 bits (75), Expect = 0.19 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 3/72 (4%) Query: 180 QLFKEIEIYFSLEGE--RWQEDFISMEPKQDRVSEHARIIHVDLENRTAKHVMMKLYFQH 237 QL + I FS +GE W+ + K+ R+ A + VD+ T K+V + Sbjct: 808 QLVDGVVISFSEDGEYYAWKTVYEPSVGKR-RMKNRALFLEVDISPNTGKYVTCDFIYHG 866 Query: 238 EWILISEVTFKS 249 W+L+SEV S Sbjct: 867 WWVLLSEVQIVS 878 >SB_57625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1751 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Query: 16 KLNFHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 K + ++P N N L PF+A VR+FP A + CMR+EL+GCR Sbjct: 566 KTEQNQEKILPANTNKDDPVVNWLSLPFVAWSVRIFPLAWN-TAVCMRIELFGCR 619 Score = 31.1 bits (67), Expect = 1.8 Identities = 17/65 (26%), Positives = 29/65 (44%) Query: 3 RKTLLPYEKFTNRKLNFHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACM 62 R+ L +NR + H + GN + + ++TL+ + VRV P C+ Sbjct: 320 RENTLNKSLTSNRNDDCHYLQVFDGNYDRDSVVQSTLDEGDVMRYVRVSPVTHQGNRVCL 379 Query: 63 RVELY 67 R E+Y Sbjct: 380 RTEVY 384 >SB_28427| Best HMM Match : fn3 (HMM E-Value=1.3e-07) Length = 276 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/46 (36%), Positives = 25/46 (54%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 + GNV+ T + + P A +RV P A + ACMR++ YGC Sbjct: 1 IFDGNVDHNTGRVNWFKVPIAAQFIRVHPQAVNGGNACMRIDFYGC 46 >SB_51328| Best HMM Match : F5_F8_type_C (HMM E-Value=8.7e-33) Length = 184 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 + GNV+++T L+ P IA VR+ P + C+RVELYGC Sbjct: 138 IFDGNVDSFTVHHNNLKTPVIARYVRINP-RTWEKGICLRVELYGC 182 >SB_25734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1938 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/46 (36%), Positives = 24/46 (52%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 + GN + T + E P A +RV P A + ACMR++ YGC Sbjct: 597 IFDGNEDHKTGRVNWFEVPIAAQFIRVHPQAVNSGNACMRIDFYGC 642 Score = 35.5 bits (78), Expect = 0.083 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 GN + T K TL P +A +R P + H R MRVE+YG + Sbjct: 116 GNTDGTTVVKNTLAVPTMARFIRFVPLS-HNRDPTMRVEVYGTK 158 >SB_55360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 41.1 bits (92), Expect = 0.002 Identities = 23/65 (35%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Query: 25 IPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWKQALIAYSAPKGG 84 + GN N L PF A +R+FP C+R ELYGC + A A +GG Sbjct: 1159 LQGNSNANNVANIMLAEPFNARFIRIFP-LTWSNNICIRTELYGCASQDAR-AVCNGRGG 1216 Query: 85 DMQSM 89 D+ S+ Sbjct: 1217 DLLSI 1221 >SB_41161| Best HMM Match : TSP_1 (HMM E-Value=6e-22) Length = 649 Score = 39.9 bits (89), Expect = 0.004 Identities = 19/54 (35%), Positives = 30/54 (55%) Query: 16 KLNFHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 +L +++ GN++ + K L F A VR +P A + + CMR+ELYGC Sbjct: 3 QLIVYLSKAFVGNIDKDSVKIHWLTKFFDARFVRFYPLAWYGESICMRIELYGC 56 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 39.5 bits (88), Expect = 0.005 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 GN++T T K T+ FIA VR+ P + + C+R E+YGC Sbjct: 1607 GNIDTSTVTKNTVFPSFIARYVRINP-TSWESSICLRAEIYGC 1648 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 39.5 bits (88), Expect = 0.005 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Query: 22 NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 + + GN + ++ K L P IA +++ P H + CMRVE YGCR Sbjct: 1122 DKMFRGNNDQHSIKTNALSPPVIARYLKIVPRGWHG-SICMRVEFYGCR 1169 Score = 37.9 bits (84), Expect = 0.016 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Query: 22 NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 + ++ NV+ Y+ + L A +++ P H R CMR+E YGCR Sbjct: 108 DKMLKANVDNYSVRSNALSPAVRARYIKLVPRGWHSRI-CMRLEFYGCR 155 Score = 37.1 bits (82), Expect = 0.027 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 7/67 (10%) Query: 9 YEKFTNRKLNFHMNS------LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACM 62 Y K+++ ++++ M+ L GN + Y+T ++ P +A VR+ P + + R C+ Sbjct: 2140 YVKYSSDEIHWTMDKKKNSWKLYNGNRDQYSTVTESINPPILARYVRINPRSWYAR-MCL 2198 Query: 63 RVELYGC 69 R E YGC Sbjct: 2199 RAEFYGC 2205 Score = 35.5 bits (78), Expect = 0.083 Identities = 18/29 (62%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Query: 42 PFIASIVRVFPYAAHPRTACMRVELYGCR 70 PFIA VRV P H R A +RVEL+GCR Sbjct: 2331 PFIARYVRVNPKTWHSRIA-LRVELFGCR 2358 Score = 34.7 bits (76), Expect = 0.15 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Query: 28 NVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 NV+ + + +L P +A R++P+ H R A +R EL GCR Sbjct: 4426 NVDQNSIAQRSLSPPIVARYFRIYPWGWHGRIA-LRFELLGCR 4467 Score = 33.9 bits (74), Expect = 0.25 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 GN + L P A VR+ PY+ A MRVELYGCR Sbjct: 4577 GNYERFHVVYNRLFRPIKARYVRIHPYSWQSYIA-MRVELYGCR 4619 Score = 33.5 bits (73), Expect = 0.34 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 8/65 (12%) Query: 5 TLLPYEKFTNRKLNFHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRV 64 T PY++ RK+ GN + + K T P A +RV P + A MRV Sbjct: 4002 TFTPYKEAGRRKV-------FRGNWDQFIVKTNTFRRPIRARYIRVHPVTWYS-WASMRV 4053 Query: 65 ELYGC 69 E YGC Sbjct: 4054 EFYGC 4058 Score = 33.1 bits (72), Expect = 0.44 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 + GN + Y L P +A VR+ P + A +R E+YGCR Sbjct: 265 IFQGNNDRYRVNVLRLIPPVVAQYVRIHPQTWYGHVA-LRTEIYGCR 310 Score = 32.7 bits (71), Expect = 0.59 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 + GN + Y T + P RV P + H R A MR+E +GC Sbjct: 725 IFEGNYDRYIPVTNTFKTPLNGRYFRVHPVSWHSRIA-MRLEFFGC 769 Score = 32.7 bits (71), Expect = 0.59 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Query: 21 MNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWK 72 M + GN + Y + A VRV P A H R MRVELYG R+K Sbjct: 3685 MTMVFEGNYDNYHIVAHRIAPMISARYVRVHPKAWH-RGIGMRVELYGRRYK 3735 Score = 32.3 bits (70), Expect = 0.78 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 42 PFIASIVRVFPYAAHPRTACMRVELYGCRWKQ 73 P VR+ P + + R A MRVELYGC W + Sbjct: 2802 PIYGRYVRINPRSWYSRIA-MRVELYGCAWNR 2832 Score = 32.3 bits (70), Expect = 0.78 Identities = 23/70 (32%), Positives = 30/70 (42%), Gaps = 8/70 (11%) Query: 9 YEKFTNRKLNF----HMNS---LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTAC 61 Y F+ K+NF H N + GN + K + I +R+ P A Sbjct: 3837 YLYFSQDKVNFAILRHWNGVPKMFHGNRDNRGIKTNAIFPTIITRYLRIRPMGRRGLNA- 3895 Query: 62 MRVELYGCRW 71 MRVELYGC W Sbjct: 3896 MRVELYGCNW 3905 Score = 32.3 bits (70), Expect = 0.78 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 L+ GN + T + F A V++ P + H + MRVELYGC Sbjct: 6964 LLTGNSDRNTVVMNRIAPSFRARYVKIVPKSWHSHMS-MRVELYGC 7008 Score = 31.9 bits (69), Expect = 1.0 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 + N NTYT + ++ A +R P H + MRVE+YGC Sbjct: 7122 IFQANRNTYTIVENAIDPTIQAKYLRFRPRGWHSHIS-MRVEVYGC 7166 Score = 31.5 bits (68), Expect = 1.4 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 5/60 (8%) Query: 45 ASIVRVFPYAAHPRTACMRVELYGCRWKQALIAYSAPKGGDMQSMTGGAKFEDMSYDGIL 104 A ++R++P+ + R MRVE+YGCR + L+ P G + +T G Y G L Sbjct: 3113 ARVLRIWPWGWY-RHIAMRVEVYGCRENRCLM----PLGTEDGRITDGQFSASTYYTGSL 3167 Score = 31.5 bits (68), Expect = 1.4 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 GN L PF A VRV P A A MRVE YGCR Sbjct: 5651 GNFERNMVVTHCLLRPFKARYVRVHPKAWQSHIA-MRVEFYGCR 5693 Score = 31.5 bits (68), Expect = 1.4 Identities = 16/27 (59%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Query: 43 FIASIVRVFPYAAHPRTACMRVELYGC 69 FIA VRV+P + R A MRVE YGC Sbjct: 6042 FIARFVRVYPRSWQGRIA-MRVEFYGC 6067 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/47 (38%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 L GN+ Y A VR+ P+ A MRVELYGCR Sbjct: 1282 LFQGNMERYRVNVHRFLPSIKARYVRIHPWTWQGHIA-MRVELYGCR 1327 Score = 30.3 bits (65), Expect = 3.1 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 + GN + Y T T + P RV P + + MR+E YGC Sbjct: 1818 IFQGNYDRYITVTHTFKRPLTGRYFRVHPVTWYSHIS-MRLEFYGC 1862 Score = 30.3 bits (65), Expect = 3.1 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Query: 12 FTNRKLNFHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 FT + H + GN + YT + ++ P A R+ P H + MR+ELYGC Sbjct: 6601 FTTYREGRHAK-IFQGNYDRYTVVRNSIR-PVTARYCRLRPRTWHGHIS-MRMELYGC 6655 Score = 29.9 bits (64), Expect = 4.1 Identities = 13/52 (25%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 22 NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWKQ 73 N + N + Y+ + +R+ P + H + M++ELYGC W + Sbjct: 568 NKNVYSNWDGYSVETQAFTPALYGKYIRIEPRSWHGPIS-MKIELYGCNWNR 618 Score = 29.9 bits (64), Expect = 4.1 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWKQALI 76 GN + T K A VR+ P+ A MRVE YGC L+ Sbjct: 1441 GNRDRNTIKSNVFNPSIRARFVRIVPWRWRSHIA-MRVEFYGCHISACLL 1489 Score = 29.9 bits (64), Expect = 4.1 Identities = 27/100 (27%), Positives = 41/100 (41%), Gaps = 7/100 (7%) Query: 6 LLPYEKFTNRKLNFHMNS---LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACM 62 +L Y K + FH + L GN + + T + A +R+ P + R + Sbjct: 1573 VLSYSKDGTKFRYFHSYNGLKLFRGNFDYFHTVTNRITPNIKARYIRIHPRTWY-RYIGL 1631 Query: 63 RVELYGCRWKQALIAYSAPKGGDMQSMTGGAKFEDMSYDG 102 RVELYGCR + Y A G + + SY+G Sbjct: 1632 RVELYGCRQGE---NYCAKPLGFQRGKRTNLRLSASSYNG 1668 Score = 29.9 bits (64), Expect = 4.1 Identities = 17/52 (32%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Query: 19 FHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 F N + GN + Y T + +R+ P MRVELYGCR Sbjct: 2620 FGKNRVFQGNYDRYNTVVRRISPHINCRYLRIHPRTWQTYIG-MRVELYGCR 2670 Score = 29.9 bits (64), Expect = 4.1 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 GN + Y K P A +RV P + MRVELYGC Sbjct: 5041 GNYDRYIVVKHAFVRPITARYLRVHPLKWRSWIS-MRVELYGC 5082 Score = 29.5 bits (63), Expect = 5.5 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWKQALIAYSAPKG 83 GN + + ++ VR+ P + + R MR+EL+GCR IA A G Sbjct: 6463 GNYDMGSVVTNAFRPAIVSRFVRIHPRSWY-RHIAMRIELHGCRPAPCDIALGAEDG 6518 Score = 29.1 bits (62), Expect = 7.2 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 20 HMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWK 72 H N + GN + + L A VR+ P + R MR E YGC+ K Sbjct: 5800 HNNKMFDGNRDINSVVSHGLSPSIRARYVRIHPRGWY-RHIAMRAEFYGCQIK 5851 >SB_40430| Best HMM Match : F5_F8_type_C (HMM E-Value=1.6e-19) Length = 253 Score = 38.7 bits (86), Expect = 0.009 Identities = 18/47 (38%), Positives = 26/47 (55%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 + GN + ++TL P +A +RV P +TACMR EL GC+ Sbjct: 165 IFTGNSDGKGRVRSTLLVPIVAVYIRVRPITWQGQTACMRFELIGCK 211 >SB_47160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1806 Score = 38.7 bits (86), Expect = 0.009 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 GN T K L PF A +RV P + + C+R+ELYGC+ Sbjct: 1177 GNTEHNLTVKNVLSKPFTAKSIRVHPVTWYNK-ICLRLELYGCK 1219 Score = 38.3 bits (85), Expect = 0.012 Identities = 15/40 (37%), Positives = 24/40 (60%) Query: 31 TYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 T + TL P +A +++ P + TAC+R+ELYGC+ Sbjct: 751 TLKSGNVTLPVPIVAVFIQIRPMEWNGSTACLRLELYGCK 790 >SB_41915| Best HMM Match : F5_F8_type_C (HMM E-Value=9.1e-13) Length = 317 Score = 38.7 bits (86), Expect = 0.009 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 GN + K L PF A IVR++P ++ R+A +R+ELYGC Sbjct: 273 GNTDRNGVVKHALRDPFEAKIVRIYPTDSNTRSA-LRLELYGC 314 >SB_20601| Best HMM Match : F5_F8_type_C (HMM E-Value=9.5e-24) Length = 405 Score = 38.7 bits (86), Expect = 0.009 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 3/69 (4%) Query: 18 NFHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWKQALIA 77 N +++ GNV T LE F +R++P + CM++E+YGCR++ Sbjct: 196 NLRNENILSGNVEKEGTVLNVLEPYFTTRYIRIYPRSFFS-FICMKLEIYGCRFRCG--G 252 Query: 78 YSAPKGGDM 86 + P GD+ Sbjct: 253 FLPPTPGDL 261 >SB_15475| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 417 Score = 38.7 bits (86), Expect = 0.009 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 4/66 (6%) Query: 10 EKFTNRKLNFHMNSLIPGNV-NTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYG 68 E F+ K + ++ GN N Y TK E P +A VR+ P ++H + AC+R+ELYG Sbjct: 112 EAFSAYK-EYQKEVILYGNSDNNYVTKNVLREYP-VARRVRILPLSSHGQ-ACLRIELYG 168 Query: 69 CRWKQA 74 ++A Sbjct: 169 ISIQEA 174 >SB_42690| Best HMM Match : F5_F8_type_C (HMM E-Value=7.49695e-43) Length = 257 Score = 38.3 bits (85), Expect = 0.012 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 GN + T K TL P +A +R P+ +H R MRVE+YG R Sbjct: 116 GNTDGTTVVKNTLAVPTMARFIRFVPF-SHNRDPTMRVEVYGTR 158 >SB_55359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2516 Score = 37.9 bits (84), Expect = 0.016 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 2/66 (3%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWKQALIAYSAPKG 83 ++ G+ ++ T L+ P A VR++P ++ C+R+E+YGC + A A +G Sbjct: 562 VLNGSSDSDTVANIMLKDPINARFVRIYP-SSWSNNICLRIEIYGCASQDAR-ATCLGQG 619 Query: 84 GDMQSM 89 GD+ S+ Sbjct: 620 GDLLSI 625 Score = 32.3 bits (70), Expect = 0.78 Identities = 15/43 (34%), Positives = 20/43 (46%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 GN +T + L P VR+ P A P C+R + YGC Sbjct: 2073 GNGDTKSHLTHVLGEPIRTRYVRLLPVAGSPDGKCLRFDFYGC 2115 >SB_1173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 406 Score = 37.9 bits (84), Expect = 0.016 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPR-TACMRVELYGC 69 + GN + + + L P IA ++RV P ACMR+E+YGC Sbjct: 147 IFSGNDDAQSIVRNALRVPIIARLIRVLPLDKKQHGLACMRLEMYGC 193 >SB_40575| Best HMM Match : F5_F8_type_C (HMM E-Value=1.7e-25) Length = 219 Score = 37.5 bits (83), Expect = 0.021 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Query: 12 FTNRKLNFHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRW 71 ++ +K ++ + +I N + + P A +R+ P A + R A MRVELYGC+W Sbjct: 160 YSRQKEWYNSDKIIYANWDRKSVHTHAFVPPLYARYIRIKPRAWYSRIA-MRVELYGCKW 218 Score = 30.3 bits (65), Expect = 3.1 Identities = 23/81 (28%), Positives = 34/81 (41%), Gaps = 4/81 (4%) Query: 22 NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWKQALIAYSAP 81 N L GN + + T + A +R+ P + R +RVELYGCR + Y A Sbjct: 12 NILFRGNFDYFHTVTNRITPNIKARYIRIHPRTWY-RYIGLRVELYGCRQGE---NYCAK 67 Query: 82 KGGDMQSMTGGAKFEDMSYDG 102 G + + SY+G Sbjct: 68 PLGFQRGKRTNLRLSASSYNG 88 >SB_38824| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 604 Score = 37.5 bits (83), Expect = 0.021 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 GN + T K + P +RVFP + ++C+R+ELYGC+ Sbjct: 382 GNEDRTTVKVNWFDVPVAVRYIRVFPVTSQG-SSCLRMELYGCK 424 Score = 33.5 bits (73), Expect = 0.34 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 4/68 (5%) Query: 4 KTLLPYEKFTNRKLNFHMNSLIP---GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTA 60 K LL Y N +++ N + GN + L +A VR+ P H R A Sbjct: 102 KFLLRYSSDDNTYIDYRENGRVRTFYGNQDRDGKVHQILYNEIVARFVRIIPLTFHAR-A 160 Query: 61 CMRVELYG 68 CMR E+YG Sbjct: 161 CMRAEIYG 168 >SB_1519| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 943 Score = 36.7 bits (81), Expect = 0.036 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 LIPG+ + + T K L+ P +A +RV+P + MR++ +G R Sbjct: 621 LIPGSKDRFDTAKHVLQRPVVAKFIRVYPVEFYSHKT-MRIDAFGVR 666 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYG 68 GN + + K L P A +RV + H +AC+RVELYG Sbjct: 468 GNFDKSSVVKHQLNEPIRARYIRVSA-SKHRGSACLRVELYG 508 >SB_56863| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4248 Score = 36.3 bits (80), Expect = 0.048 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 GN + T K L +P + +VR P H R CMRVE+ GC+ Sbjct: 497 GNTISNLTVKHLLASPVVGRLVRFLPTTWHNR-ICMRVEICGCK 539 >SB_22736| Best HMM Match : F5_F8_type_C (HMM E-Value=6.4e-24) Length = 1039 Score = 36.3 bits (80), Expect = 0.048 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 GN + T K L +P + +VR P A + R CMRVE++GC+ Sbjct: 482 GNSISNLTVKHLLASPVVGRLVRFLPTAWYNRI-CMRVEVFGCK 524 >SB_22289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1102 Score = 36.3 bits (80), Expect = 0.048 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 GN + Y+ KTTL P IA +R+ P + + A +++E+YGC Sbjct: 943 GNTDYYSVVKTTLHTPRIARFIRLQPVSWNHDIA-LKMEIYGC 984 >SB_24622| Best HMM Match : F5_F8_type_C (HMM E-Value=7.4e-17) Length = 897 Score = 35.9 bits (79), Expect = 0.063 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Query: 22 NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 N GN ++ T K + P IAS V + P A H +RVELYGC+ Sbjct: 244 NRTFVGNSDSNTVKFNPIPLPAIASSVTLQPQAWHGNIG-LRVELYGCK 291 >SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1814 Score = 35.9 bits (79), Expect = 0.063 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 + GN + +T L I V+ P H R CMRVELYGC+ Sbjct: 1137 IFSGNTDLISTVNNVLTEKLITKAVKFRPKEWHTRI-CMRVELYGCK 1182 >SB_11950| Best HMM Match : Pentaxin (HMM E-Value=0.12) Length = 494 Score = 35.9 bits (79), Expect = 0.063 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 26 PGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 PGN + Y + + P I VR+ P H A MRVE+YGC Sbjct: 4 PGNSDCYRVVQNDVNPPIIGWYVRLHPVKWHIHPA-MRVEMYGC 46 >SB_11891| Best HMM Match : F5_F8_type_C (HMM E-Value=4.7e-35) Length = 1171 Score = 35.9 bits (79), Expect = 0.063 Identities = 15/47 (31%), Positives = 23/47 (48%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 + GN N K L P +A +R+ P TAC+R++ GC+ Sbjct: 414 IFAGNTNGNNIAKRDLPGPIVAVYIRIKPVTWVGYTACLRIDFKGCK 460 >SB_1520| Best HMM Match : F5_F8_type_C (HMM E-Value=1.4e-19) Length = 501 Score = 35.9 bits (79), Expect = 0.063 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYG 68 LIPG+ + + T K L+ P +A +RV+P + MR++++G Sbjct: 149 LIPGSKDRFDTAKHVLQRPVVAKFIRVYPVEFYSHKT-MRIDVFG 192 Score = 28.7 bits (61), Expect = 9.6 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 L+ GN + T + L P +A VR+ P +H + C +L+G R Sbjct: 334 LVKGNSDGTGTAVSWLVRPVVARFVRITPKTSHGK-PCFAFDLHGYR 379 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 35.5 bits (78), Expect = 0.083 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Query: 27 GNVNTYT-TKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWKQAL 75 GN++ TK L P + + +R+ P CMR+ELYGC +A+ Sbjct: 119 GNLDKVNVTKINRLIPPIMVNTIRIIPEIYPVNQVCMRIELYGCLLTKAI 168 >SB_27203| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 527 Score = 35.5 bits (78), Expect = 0.083 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 GN + T K TL P +A +R P + H R MRVE+YG + Sbjct: 138 GNTDGTTVVKNTLAVPTMARFIRFVPLS-HNRDPTMRVEVYGTK 180 >SB_505| Best HMM Match : F5_F8_type_C (HMM E-Value=4.80645e-43) Length = 235 Score = 35.5 bits (78), Expect = 0.083 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Query: 22 NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 + + GN + T K TL P +A +R P + H R MRVE+YG + Sbjct: 89 DKVFTGNTDGTTVVKNTLAVPTMARFIRFVPLS-HNRYPTMRVEVYGTK 136 >SB_48166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 35.1 bits (77), Expect = 0.11 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Query: 28 NVNTYTTKKTTLEAPFIASIVRVFPYA-AHPRTACMRVELYGC 69 N ++ T K L P +A VR+ P + A CMRVELYGC Sbjct: 145 NNDSATVVKNILTRPILARKVRIEPKSLAEYGAICMRVELYGC 187 >SB_29271| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 796 Score = 35.1 bits (77), Expect = 0.11 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYG 68 LIPG+ + + T K L+ P +A +RV+P + MR++ +G Sbjct: 646 LIPGSKDRFDTAKHVLQRPVVAKFIRVYPVEFYSHKT-MRIDAFG 689 Score = 30.3 bits (65), Expect = 3.1 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Query: 28 NVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYG 68 N + + T L P IA +R+FP H M+VELYG Sbjct: 2 NQDKHRTSYNGLPVPIIAKFIRIFP-KDHYVHKTMKVELYG 41 >SB_7856| Best HMM Match : F5_F8_type_C (HMM E-Value=3.6e-11) Length = 334 Score = 35.1 bits (77), Expect = 0.11 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 36 KTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 +T L AP A +VR +P+ + CMRVE+YGC Sbjct: 124 RTNLTAPVRARLVRFWPWRSEGNP-CMRVEVYGC 156 >SB_48467| Best HMM Match : F5_F8_type_C (HMM E-Value=1.4e-21) Length = 418 Score = 35.1 bits (77), Expect = 0.11 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 GN + +++ PF A VRV P + H CMRVELY C Sbjct: 152 GNDRREEVQTNSIKYPFPARFVRVHPVSWH--LICMRVELYSC 192 >SB_20185| Best HMM Match : F5_F8_type_C (HMM E-Value=1.3e-23) Length = 470 Score = 35.1 bits (77), Expect = 0.11 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query: 26 PGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 PG + Y T K L A +R+ + CMR+ELYGCR Sbjct: 158 PGPSSKYDTSKVDLTPAVYARFIRIAAISWETHV-CMRIELYGCR 201 >SB_11594| Best HMM Match : F5_F8_type_C (HMM E-Value=4.4e-35) Length = 1814 Score = 35.1 bits (77), Expect = 0.11 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Query: 23 SLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 ++ GN++ + K+ L P +A +R +P + CMRVE++GC Sbjct: 115 TIFSGNIDNMSVKENLLLPPVVARGIRFYPKDFY-NWKCMRVEVFGC 160 >SB_22840| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4002 Score = 34.7 bits (76), Expect = 0.15 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWK 72 GN + +T L P +A +R +P + H + MRVELYG R K Sbjct: 2317 GNYDRHTVVVRRLRPPILARYIRFYPLSWHGHIS-MRVELYGKRLK 2361 Score = 29.9 bits (64), Expect = 4.1 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Query: 12 FTNRKLNF-HMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 ++N NF + GN + +T + A +R+ P + + MR+ELYG R Sbjct: 160 YSNNGRNFKRYPRIFAGNFDRHTVVTRIIRPAIRARFIRIHPRNWYGHIS-MRIELYGKR 218 Query: 71 WKQALIAYSAPK 82 + +I PK Sbjct: 219 GRPGVIPKPRPK 230 >SB_57522| Best HMM Match : F5_F8_type_C (HMM E-Value=0.004) Length = 209 Score = 34.3 bits (75), Expect = 0.19 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYG 68 GN++ + ++T+ A IA ++R+ P H ACMR+E+YG Sbjct: 23 GNLDRDSIVQSTIYAKPIARVIRIVPLN-HVGVACMRLEIYG 63 >SB_46586| Best HMM Match : F5_F8_type_C (HMM E-Value=2.7e-15) Length = 311 Score = 34.3 bits (75), Expect = 0.19 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYG 68 GN++ + ++T+ A IA ++R+ P H ACMR+E+YG Sbjct: 249 GNLDRDSIVQSTIYAKPIARVIRIVPLN-HVGVACMRLEIYG 289 >SB_58926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2371 Score = 33.9 bits (74), Expect = 0.25 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Query: 25 IPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELY 67 + GN T T L+ P A +VR+ P AH CMR+E+Y Sbjct: 1528 LTGNSAANTVMTTWLDDPIGARLVRIRP-TAHESGVCMRIEIY 1569 Score = 33.1 bits (72), Expect = 0.44 Identities = 24/73 (32%), Positives = 31/73 (42%), Gaps = 2/73 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWKQALIAYSAPKGGDM 86 GN + + K L A+ VR P H ACMRVE+YG A P G D Sbjct: 784 GNADRSSKVKNLLLGNPEATTVRFLPRQWHGLIACMRVEVYGSLASPA--CADVPVGLDS 841 Query: 87 QSMTGGAKFEDMS 99 +S+ +F S Sbjct: 842 ESLVMDHRFTSSS 854 Score = 33.1 bits (72), Expect = 0.44 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYG 68 GN ++ + K L +A VR+ P H AC+R E+YG Sbjct: 1274 GNFDSQSVVKQDLSEVLVARFVRMLP-VTHHTAACLRAEIYG 1314 Score = 31.1 bits (67), Expect = 1.8 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYG 68 GN + + K L +A +VR+ ++ + CMRVELYG Sbjct: 1898 GNTDRLSEKYHRLNDSIVARVVRIL-VTSYQTSPCMRVELYG 1938 Score = 30.7 bits (66), Expect = 2.4 Identities = 19/48 (39%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Query: 23 SLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 ++ GN + T K T A VRV P MRVELYGCR Sbjct: 1434 AIFNGNTDKTTVVKRTFSMVTAARYVRVNPMTFQGYKQ-MRVELYGCR 1480 Score = 30.3 bits (65), Expect = 3.1 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 10 EKFTNRKLNFHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 E + K ++ + GN + L+ PF++ VRV P C+RV+ YGC Sbjct: 1107 EDWVEYKAGQNILKTLAGNSDGSRVAVNWLQYPFMSRHVRVTPQTWR-NAICLRVDFYGC 1165 >SB_56972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 868 Score = 33.9 bits (74), Expect = 0.25 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 22 NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWKQALIAYSAP 81 + + GN + +T LE PF A +R+ A C+R+ELYGC + + +P Sbjct: 253 DKMFQGNRDRFTPVTHWLEKPFYAIGIRIIAMA-WDELICIRLELYGCAIPGSEVKCISP 311 Query: 82 KG 83 G Sbjct: 312 LG 313 >SB_56512| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1219 Score = 33.9 bits (74), Expect = 0.25 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 + GN + T + L P +A VRV P R A MRVE++GC Sbjct: 1058 IFEGNKDRSTVRSHALAMPILARYVRVRPMTWRGRIA-MRVEIFGC 1102 >SB_10333| Best HMM Match : ATP1G1_PLM_MAT8 (HMM E-Value=0.73) Length = 150 Score = 33.9 bits (74), Expect = 0.25 Identities = 16/31 (51%), Positives = 21/31 (67%) Query: 217 IHVDLENRTAKHVMMKLYFQHEWILISEVTF 247 + VDL TAK V ++ ++ EWILISEV F Sbjct: 5 VTVDLCLHTAKSVRLEFNYRGEWILISEVAF 35 >SB_51551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 33.9 bits (74), Expect = 0.25 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFP--YAAHPRTACMRVELYGC 69 GN + + K L P IA ++R+ P Y + C+R E++GC Sbjct: 363 GNFDAQSIVKRALNPPIIAKLIRIIPTSYNSTMYHICLRAEVHGC 407 >SB_51486| Best HMM Match : F5_F8_type_C (HMM E-Value=3.3e-22) Length = 181 Score = 33.5 bits (73), Expect = 0.34 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Query: 11 KFTNRKLNFHM---NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELY 67 +++ +++FH + GN + + L+ IA +RV P A H + MRV LY Sbjct: 41 EYSQNRVHFHSYLSGKVFQGNHDRNSKLSHILKPAIIARYIRVRPQAWHAHIS-MRVGLY 99 Query: 68 GCR 70 GCR Sbjct: 100 GCR 102 >SB_49607| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4538 Score = 33.5 bits (73), Expect = 0.34 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWKQALI 76 GN++ T K L A +R+ P + + R AC R+E+YG K+ + Sbjct: 636 GNIDANTVVKNALNKSIEARFIRIHPVSWN-RRACTRLEIYGFEVKKTFL 684 >SB_39853| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 254 Score = 33.5 bits (73), Expect = 0.34 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Query: 11 KFTNRKLNFHM---NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELY 67 +++ +++FH + GN + + L+ IA +RV P A H + MRV LY Sbjct: 90 EYSQNRVHFHSYLSGKVFQGNHDRNSKLSHILKPAIIARYIRVRPQAWHAHIS-MRVGLY 148 Query: 68 GCR 70 GCR Sbjct: 149 GCR 151 >SB_37238| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1003 Score = 33.5 bits (73), Expect = 0.34 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 26 PGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 PGN + T + P I VR+ P H A MRVE+YGC Sbjct: 458 PGNSDYTTVVHNDVNPPIIGWYVRLHPVKWHIHPA-MRVEMYGC 500 >SB_19278| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 303 Score = 33.5 bits (73), Expect = 0.34 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Query: 11 KFTNRKLNFHM---NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELY 67 +++ +++FH + GN + + L+ IA +RV P A H + MRV LY Sbjct: 84 EYSQNRVHFHSYLSGKVFQGNHDRNSKLSHILKPAIIARYIRVRPQAWHAHIS-MRVGLY 142 Query: 68 GCR 70 GCR Sbjct: 143 GCR 145 >SB_4535| Best HMM Match : F5_F8_type_C (HMM E-Value=3.92364e-44) Length = 972 Score = 33.5 bits (73), Expect = 0.34 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 26 PGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 PGN N K LE P +++ P + C+R+ELYGC Sbjct: 44 PGNTNGGEVVKNLLEPPTAGQHMKIEPVTWY-NMPCLRLELYGC 86 >SB_20001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 722 Score = 33.5 bits (73), Expect = 0.34 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Query: 11 KFTNRKLNFHM---NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELY 67 +++ +++FH + GN + + L+ IA +RV P A H + MRV LY Sbjct: 289 EYSQNRVHFHSYLSGKVFQGNHDRNSKLSHILKPAIIARYIRVRPQAWHAHIS-MRVGLY 347 Query: 68 GCR 70 GCR Sbjct: 348 GCR 350 Score = 33.5 bits (73), Expect = 0.34 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Query: 11 KFTNRKLNFHM---NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELY 67 +++ +++FH + GN + + L+ IA +RV P A H + MRV LY Sbjct: 550 EYSQNRVHFHSYLSGKVFQGNHDRNSKLSHILKPAIIARYIRVRPQAWHTHIS-MRVGLY 608 Query: 68 GCR 70 GCR Sbjct: 609 GCR 611 >SB_18969| Best HMM Match : F5_F8_type_C (HMM E-Value=8.4e-38) Length = 488 Score = 33.5 bits (73), Expect = 0.34 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Query: 11 KFTNRKLNFHM---NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELY 67 +++ +++FH + GN + + L+ IA +RV P A H + MRV LY Sbjct: 417 EYSQNRVHFHSYLSGKVFQGNHDRNSKLSHILKPAIIARYIRVRPQAWHAHIS-MRVGLY 475 Query: 68 GCR 70 GCR Sbjct: 476 GCR 478 >SB_5362| Best HMM Match : F5_F8_type_C (HMM E-Value=8.4e-38) Length = 199 Score = 33.5 bits (73), Expect = 0.34 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Query: 11 KFTNRKLNFHM---NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELY 67 +++ +++FH + GN + + L+ IA +RV P A H + MRV LY Sbjct: 136 EYSQNRVHFHSYLSGKVFQGNHDRNSKLSHILKPAIIARYIRVRPQAWHAHIS-MRVGLY 194 Query: 68 GCR 70 GCR Sbjct: 195 GCR 197 Score = 31.9 bits (69), Expect = 1.0 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR--WKQALIAYSAP 81 ++ GN + T ++ P A VR +P H + MRVELYGCR + L+ +AP Sbjct: 1 VLSGNKDRNTVVTHSV-GPIYARYVRFYPQTWHGHIS-MRVELYGCRRGFVDPLVKCAAP 58 >SB_19041| Best HMM Match : F5_F8_type_C (HMM E-Value=3e-29) Length = 156 Score = 33.1 bits (72), Expect = 0.44 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 + GN + Y L P +A VR+ P + A +R E+YGCR Sbjct: 109 IFQGNNDRYRVNVLRLIPPVVAQYVRIHPQTWYGHVA-LRTEIYGCR 154 >SB_23467| Best HMM Match : F5_F8_type_C (HMM E-Value=1.3e-19) Length = 162 Score = 32.7 bits (71), Expect = 0.59 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Query: 26 PGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 PG + Y T K +R+ + CMR+ELYGCR Sbjct: 111 PGPSSKYDTSKVNFTPAVYTRFIRIVALSWETHV-CMRIELYGCR 154 >SB_13998| Best HMM Match : Kringle (HMM E-Value=0.0016) Length = 832 Score = 32.7 bits (71), Expect = 0.59 Identities = 15/34 (44%), Positives = 17/34 (50%) Query: 39 LEAPFIASIVRVFPYAAHPRTACMRVELYGCRWK 72 L P A R +P ACM+V LYGCR K Sbjct: 569 LPVPITARHFRFYPEKLPGTVACMKVRLYGCRGK 602 >SB_52098| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 308 Score = 32.7 bits (71), Expect = 0.59 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Query: 7 LPYEKFTNRKLNFHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVEL 66 L Y + L++ + GN + + L+ IA +RV P A H + MRV L Sbjct: 135 LEYSQNRVHFLSYLSGKVFQGNHDRNSKLSHILKPAIIARYIRVRPQAWHAHIS-MRVGL 193 Query: 67 YGCR 70 YGCR Sbjct: 194 YGCR 197 Score = 31.9 bits (69), Expect = 1.0 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR--WKQALIAYSAP 81 ++ GN + T ++ P A VR +P H + MRVELYGCR + L+ +AP Sbjct: 1 VLSGNKDRNTVVTHSV-GPIYARYVRFYPQTWHGHIS-MRVELYGCRRGFVDPLVKCAAP 58 >SB_2124| Best HMM Match : F5_F8_type_C (HMM E-Value=0.0055) Length = 596 Score = 32.7 bits (71), Expect = 0.59 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 L GN + T + ++ P IAS V++ P H +R+EL+GC Sbjct: 308 LFQGNYDASTVVRQSILRPVIASRVKLIPIEWHTNVG-LRMELFGC 352 >SB_48144| Best HMM Match : F5_F8_type_C (HMM E-Value=2e-19) Length = 502 Score = 32.3 bits (70), Expect = 0.78 Identities = 13/26 (50%), Positives = 19/26 (73%) Query: 45 ASIVRVFPYAAHPRTACMRVELYGCR 70 A+ +RV P A + T C+R+ELYGC+ Sbjct: 296 ATAIRVRPLAWNGLTNCLRMELYGCK 321 >SB_24688| Best HMM Match : F5_F8_type_C (HMM E-Value=4.6e-14) Length = 226 Score = 32.3 bits (70), Expect = 0.78 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 L PGNV++ T TT P I +V + + R+E YGC Sbjct: 180 LFPGNVHSIATVNTTFTPPVIGRFFKVTTKECY-QCCSFRLEFYGC 224 >SB_39600| Best HMM Match : Sushi (HMM E-Value=0) Length = 1368 Score = 32.3 bits (70), Expect = 0.78 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPR----TACMRVELYGC 69 GN N T K L+ IA VR++ + T C+RVE YGC Sbjct: 1153 GNENRNTVVKHELKPTIIAQKVRIYRHQELKEFSGSTVCLRVEFYGC 1199 >SB_51087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 31.9 bits (69), Expect = 1.0 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 + PGN + +T APF A VR + + R MRVE+YGC Sbjct: 1 VFPGNTDASSTVFNYFTAPFPARGVRFIAQSWY-RYISMRVEIYGC 45 >SB_42106| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 929 Score = 31.9 bits (69), Expect = 1.0 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 GN + + +E PF+AS VR P + MRVE+YGC Sbjct: 178 GNTDHFNIVYHDIERPFVASYVRFRPRGWRSWIS-MRVEVYGC 219 Score = 31.1 bits (67), Expect = 1.8 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 42 PFIASIVRVFPYAAHPRTACMRVELYGCRWKQALIAYSAPKG 83 P A VR+ P + MRVELYGC W + ++ G Sbjct: 604 PIFARYVRIHPRGWRSHIS-MRVELYGCPWNKCDVSLGLEDG 644 >SB_25944| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 329 Score = 31.9 bits (69), Expect = 1.0 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Query: 25 IPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 +PGN N L+ I +RV P A MRVE+YGC Sbjct: 283 MPGNTNRDDVHVNILQPVIITRYIRVCPMLYQSHIA-MRVEMYGC 326 >SB_57638| Best HMM Match : F5_F8_type_C (HMM E-Value=1.7e-11) Length = 502 Score = 31.9 bits (69), Expect = 1.0 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Query: 7 LPYEKFTNRKLNFHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVEL 66 +PY + R+++ + GN + T + + F A +R+ P A + + C+R EL Sbjct: 295 VPYYHWPRRRVSV---KVFTGNSDQMTVVRRWFQPRFHARYLRIHPRAWN-QGICLRAEL 350 Query: 67 YGC 69 YGC Sbjct: 351 YGC 353 >SB_43390| Best HMM Match : fn3 (HMM E-Value=9.3e-30) Length = 1043 Score = 31.9 bits (69), Expect = 1.0 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 GN + K P A +RV A++ T CMR+ELYGC Sbjct: 148 GNADRDNVKVNWFTRPVGARYIRVLSTASNGAT-CMRMELYGC 189 >SB_35329| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 660 Score = 31.9 bits (69), Expect = 1.0 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 3/62 (4%) Query: 7 LPYEKFTNRKLNFHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVEL 66 + Y + +N+ N + G+ + + K TL A +R++P R AC+R+EL Sbjct: 38 ISYRQLDQDWINY--NKVFQGSNDDSSVIKYTLNTSINARFIRIYPVKWKQR-ACLRMEL 94 Query: 67 YG 68 YG Sbjct: 95 YG 96 Score = 31.5 bits (68), Expect = 1.4 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYG 68 ++ GN N + + L P A VR+ P++ + + CMRVEL G Sbjct: 367 VLTGNQNPHHVMRQELHPPITARHVRIHPHSWN-GSICMRVELIG 410 >SB_25079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Query: 25 IPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 +PGN N L+ I +RV P A MRVE+YGC Sbjct: 151 MPGNTNRDDEHVNILQPVIITRYIRVCPMQYQSHIA-MRVEIYGC 194 >SB_14824| Best HMM Match : F5_F8_type_C (HMM E-Value=1.5e-17) Length = 409 Score = 31.5 bits (68), Expect = 1.4 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 15 RKLNFHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 R+ N + GN + K P A +RV A++ T CMR+ELYGC Sbjct: 138 RQANTCLLQEFDGNSDRDNVKVNWFTRPVGARYIRVLSTASNGAT-CMRMELYGC 191 >SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3669 Score = 31.5 bits (68), Expect = 1.4 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTAC-MRVELYGCRW 71 + GN + TK T+ P + R YA + C +R+ELYGC + Sbjct: 904 IFQGNTDGRNTKNITISPPIVGQFFRF--YATKWQQYCALRMELYGCNY 950 >SB_36175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/44 (34%), Positives = 20/44 (45%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 GN + + L P + VRV P C+R ELYGC+ Sbjct: 4 GNTDGTSMLVHQLAEPVLTKYVRVKPLGGATAGTCLRFELYGCQ 47 >SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4277 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 GN + ++ K PF A VRV+P H R +R+ELY R Sbjct: 2786 GNRDRHSLKVNAFNPPFTARYVRVYPRTWH-RHISLRLELYVVR 2828 Score = 31.5 bits (68), Expect = 1.4 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 4/68 (5%) Query: 6 LLPYEKFTNRKLNFHMNSLIP---GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACM 62 ++ Y + R + + NS + GN + + + + PF A VR++P + H + M Sbjct: 3810 IVKYSQDNRRWVPYTRNSRVKVFRGNRDRSSLMENLFDPPFTARYVRIYPQSWHGHIS-M 3868 Query: 63 RVELYGCR 70 RVE Y R Sbjct: 3869 RVEFYAVR 3876 Score = 30.3 bits (65), Expect = 3.1 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYG 68 GN + Y+ K+ A VRV+P + A MR+ELYG Sbjct: 934 GNYDQYSVKENAFSPRITARYVRVYPVSWVNHIA-MRIELYG 974 Score = 30.3 bits (65), Expect = 3.1 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 L GN + T K+ + PF A VR++P + + + +R E Y R Sbjct: 2157 LFRGNRDQNTIKENLFDPPFTARFVRIYPKSWYAHIS-LRAEFYAVR 2202 Score = 29.5 bits (63), Expect = 5.5 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Query: 28 NVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWKQALIAYSA 80 NV+ L +A +VRV P A + MR+ELYG R + + A+SA Sbjct: 664 NVDRNAVVDHNLRPGIVARVVRVHPTAWASHIS-MRIELYGHRMGKRIGAWSA 715 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 31.1 bits (67), Expect = 1.8 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 + PGN + T L A VR++P + H + MR ELYG R Sbjct: 1154 VFPGNFDRNTLAVRVLRPRIFARFVRIYPRSWHGHIS-MRFELYGRR 1199 Score = 29.9 bits (64), Expect = 4.1 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Query: 12 FTNRKLNF-HMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 ++N NF + GN + +T + A +R+ P + + MR+ELYG R Sbjct: 3590 YSNNGRNFKRYPRIFAGNFDRHTVVTRIIRPAIRARFIRIHPRNWYGHIS-MRIELYGKR 3648 Query: 71 WKQALIAYSAPK 82 + +I PK Sbjct: 3649 GRPGVIPKPRPK 3660 >SB_30199| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 480 Score = 31.1 bits (67), Expect = 1.8 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Query: 22 NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 + + PGN N+ K P A +R+ C+R+ELYGC Sbjct: 113 SKVFPGNRNSNIPKSVKFSRPLTARSIRLH-IKRWSSKKCLRMELYGC 159 >SB_18091| Best HMM Match : F5_F8_type_C (HMM E-Value=3.8) Length = 113 Score = 31.1 bits (67), Expect = 1.8 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Query: 35 KKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWK 72 KK+ L +A +R+ P R + R ELYGC WK Sbjct: 77 KKSELNPSIVARAIRIQPKVYQDRPSG-RFELYGCPWK 113 >SB_50624| Best HMM Match : F5_F8_type_C (HMM E-Value=6e-10) Length = 353 Score = 31.1 bits (67), Expect = 1.8 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 GN + + L +P A +R+ P H CMRVEL GC Sbjct: 172 GNTASDSVADIILTSPIYAKYIRLRPVQWHTHV-CMRVELRGC 213 >SB_22679| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 894 Score = 31.1 bits (67), Expect = 1.8 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 L N + T K L++P A +R+ P + + MR ELYGC Sbjct: 96 LFKANRDQNTVVKNKLQSPIYARFIRIQPKKYYGHIS-MRAELYGC 140 Score = 30.3 bits (65), Expect = 3.1 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Query: 18 NFHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 ++ ++ GN + + LE IA VR+ P + + + MR+ELYGCR Sbjct: 248 SYEGGKVLKGNSDRDSKVSHILEPAIIARYVRLRPQSWYGHIS-MRLELYGCR 299 Score = 30.3 bits (65), Expect = 3.1 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Query: 18 NFHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 ++ ++ GN + + LE IA VR+ P + + + MR+ELYGCR Sbjct: 534 SYEGGKVLKGNSDRDSKVSHILEPAIIARYVRLRPQSWYGHIS-MRLELYGCR 585 >SB_22331| Best HMM Match : fn3 (HMM E-Value=7.1e-14) Length = 908 Score = 31.1 bits (67), Expect = 1.8 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 GN + K P A +RV A++ T CMR+ELYGC Sbjct: 164 GNSDRDNVKVNWFTRPVGARYIRVLSTASNGAT-CMRMELYGC 205 >SB_7978| Best HMM Match : F5_F8_type_C (HMM E-Value=1.2e-22) Length = 1151 Score = 31.1 bits (67), Expect = 1.8 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 6/68 (8%) Query: 2 ERKTLLPYEKFTNRKLNFHMNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTAC 61 E + +PY++ T F GN + +T + L+ P A +R P + C Sbjct: 1089 EGEAWVPYKEETETAKTF------AGNSDQFTLELYWLKQPLNARFLRFKPISWSSSDIC 1142 Query: 62 MRVELYGC 69 M++ +YGC Sbjct: 1143 MKIRVYGC 1150 >SB_47631| Best HMM Match : Amb_V_allergen (HMM E-Value=1.4) Length = 162 Score = 30.7 bits (66), Expect = 2.4 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 + PGN N+ K P A +R+ C+R+ELYGC Sbjct: 1 VFPGNRNSNIPKSVKFSRPLTARSIRLH-IKRWSSKKCLRMELYGC 45 >SB_13905| Best HMM Match : F5_F8_type_C (HMM E-Value=4.7e-17) Length = 321 Score = 30.7 bits (66), Expect = 2.4 Identities = 17/42 (40%), Positives = 21/42 (50%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYG 68 GN + + K L A+ VR P H ACMRVE+YG Sbjct: 274 GNADRSSKVKNLLLGNPEATTVRFLPRQWHGLIACMRVEVYG 315 >SB_12764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 30.7 bits (66), Expect = 2.4 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 GN + K P A +RV A++ T CMR+ELYGC Sbjct: 15 GNGDRDNVKVNWFTRPVGARYIRVLSTASNGAT-CMRMELYGC 56 >SB_13365| Best HMM Match : PKD_channel (HMM E-Value=1.4e-25) Length = 2146 Score = 30.3 bits (65), Expect = 3.1 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 28 NVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR 70 N + + L P + S + +FP H A +R+E+YGCR Sbjct: 112 NTDRNRVRLNYLPIPVMTSSLLLFPVKPH-NNAALRMEIYGCR 153 >SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3051 Score = 30.3 bits (65), Expect = 3.1 Identities = 16/44 (36%), Positives = 22/44 (50%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELY 67 L GN + + L+ P A VRV P + + + CMR ELY Sbjct: 633 LFNGNFDQDSIVTNPLKQPITAQYVRVRPRSWNGASICMRAELY 676 >SB_37561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1209 Score = 30.3 bits (65), Expect = 3.1 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Query: 22 NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 + + G + + + + P A VR+ P A C+R+ELYGC Sbjct: 459 DKVFTGTEDEKSVRANYFKVPLAARFVRLMP-TARKGANCVRMELYGC 505 >SB_59547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1516 Score = 29.9 bits (64), Expect = 4.1 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 4/55 (7%) Query: 37 TTLEAPFIASIVRVFPYAAHPRTACMRVELYGCR--WKQALIAYSAPKGGDMQSM 89 T L+ P IA VR+ P A + C+R ELYGC+ Q+ Y P G +++ Sbjct: 125 TLLQRP-IARYVRLNPQAWNGNI-CLRFELYGCQENGTQSSFDYPYPMSGSCENI 177 >SB_6818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1784 Score = 29.9 bits (64), Expect = 4.1 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 GN++ + + ++ P IAS V++ P H + +R+EL+GC Sbjct: 163 GNIDGSSLVRQSVLRPVIASRVKLIPIEWH-KNVGLRMELFGC 204 >SB_45697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 29.9 bits (64), Expect = 4.1 Identities = 17/80 (21%), Positives = 37/80 (46%) Query: 144 KTMQVDEEVQIIFNFSTTRTLFFVDIHTNNMFTKDVQLFKEIEIYFSLEGERWQEDFISM 203 K ++D EV+ + T+R N+ + ++LF + I ++ QE+ + + Sbjct: 410 KIEELDSEVKRMTEVLTSRDDSHCKQEVLNLLLRILRLFSDAIIKLDAYAKKQQEELVKL 469 Query: 204 EPKQDRVSEHARIIHVDLEN 223 + + D +E R + L+N Sbjct: 470 KAELDDANEKNRSLQTTLDN 489 >SB_7512| Best HMM Match : F5_F8_type_C (HMM E-Value=4.5e-30) Length = 147 Score = 29.9 bits (64), Expect = 4.1 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Query: 24 LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 + PGN + YT L P + +R+ R +R+E+YGC Sbjct: 102 VFPGNTDRYTVVYGVLAQPVVTRGIRIIAVTFEWRPV-IRLEIYGC 146 >SB_48170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 29.5 bits (63), Expect = 5.5 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Query: 23 SLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 S+ GN ++ T + L P A +R + H + MR ELYGC Sbjct: 116 SIFSGNTDSGTVARRGLVEPIKARYIRFLVKSWHGHPS-MRAELYGC 161 >SB_45521| Best HMM Match : F5_F8_type_C (HMM E-Value=8.6e-23) Length = 247 Score = 29.5 bits (63), Expect = 5.5 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Query: 21 MNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 ++ + PGN +T + L AP A VR + + MRVE+YGC Sbjct: 199 IDKVFPGNTDTSSIVYNHLAAPLPARGVRFIAQSWADHIS-MRVEIYGC 246 >SB_6072| Best HMM Match : F5_F8_type_C (HMM E-Value=1.3e-13) Length = 166 Score = 29.5 bits (63), Expect = 5.5 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Query: 17 LNFHMNS---LIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 LN+ NS + GN + + KK L+ +R++P AC+R+EL GC Sbjct: 67 LNYTENSTTRIFKGNSDRESIKKLHLKTKIAVRRLRIYPVTWFGH-ACLRLELKGC 121 >SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) Length = 684 Score = 29.5 bits (63), Expect = 5.5 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Query: 21 MNSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 ++ + PGN +T + L AP A VR + + MRVE+YGC Sbjct: 636 IDKVFPGNTDTSSIVYNHLAAPLPARGVRFIAQSWADHIS-MRVEIYGC 683 >SB_23838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 29.5 bits (63), Expect = 5.5 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Query: 10 EKFTNRKLNFHMN-SLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYG 68 +KF + H + + PGNV+ + K L + VR+ P ++ MR ELYG Sbjct: 44 DKFVLNTTSKHYSITTFPGNVDLESIVKNILNEKLVTRFVRIKP-SSWESAIVMRAELYG 102 >SB_16758| Best HMM Match : EGF_CA (HMM E-Value=5.5e-14) Length = 338 Score = 29.5 bits (63), Expect = 5.5 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Query: 23 SLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 S+ PGN + T L P +A +R+ R A +RVE+Y C Sbjct: 292 SVFPGNTDRNTVVYGVLAQPIVARGIRIIAVTFEWRPA-LRVEVYEC 337 >SB_9147| Best HMM Match : Sushi (HMM E-Value=0) Length = 1656 Score = 29.5 bits (63), Expect = 5.5 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 4/47 (8%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPR----TACMRVELYGC 69 GN N T + L+ IA VR++ + T C+R E YGC Sbjct: 1466 GNENRNTVVRHELKPTIIAQKVRIYRHQEIKEFIGSTVCLRAEFYGC 1512 >SB_34975| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 909 Score = 29.1 bits (62), Expect = 7.2 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 GN + L+ PF++ VRV P C+RV+ YGC Sbjct: 866 GNSDGSRVAVNWLQYPFMSRHVRVTPQTWR-NAICLRVDFYGC 907 >SB_29404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.1 bits (62), Expect = 7.2 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 4/52 (7%) Query: 375 LGRRDKREIHDQNEYNEICEDTEFPRPYMMKRPDPHESFYAATDIIHHCRLI 426 LG+ +++ H QNE IC D EF Y + + E F A D++ CR + Sbjct: 41 LGKTQQQQ-HQQNEELSICVDPEFKCEY-RELSESCEQF--AVDLLDQCRTL 88 >SB_9539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1642 Score = 29.1 bits (62), Expect = 7.2 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 4/52 (7%) Query: 375 LGRRDKREIHDQNEYNEICEDTEFPRPYMMKRPDPHESFYAATDIIHHCRLI 426 LG+ +++ H QNE IC D EF Y + + E F A D++ CR + Sbjct: 235 LGKTQQQQ-HQQNEELSICVDPEFKCEY-RELSESCEQF--AVDLLDQCRTL 282 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 29.1 bits (62), Expect = 7.2 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Query: 22 NSLIPGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYG 68 N + N + + K +L+ P + VR P + C+RVELYG Sbjct: 465 NQIFDANEDHDSVKTVSLQQPIVGRFVRFCPVEWYC-WPCLRVELYG 510 >SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 29.1 bits (62), Expect = 7.2 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 182 FKEIEIYFSLEGERWQEDFISMEPKQDRVSEHARIIHVDLENRTAKHVMMKLYFQHE 238 F+++ + ++ +R Q+ + M+ +QD++ + H D NR A M K FQ+E Sbjct: 196 FQQLCHVYMMQQQRMQQGY-PMQAQQDQMQFIQQQKHQDKANRIAVEAMAKAAFQNE 251 >SB_45866| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 388 Score = 28.7 bits (61), Expect = 9.6 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGC 69 GN + + K L+ F A VR P CMR ELYGC Sbjct: 106 GNTDRKSIVKHELDPAFHAVYVRFQP-KTWSGDLCMRAELYGC 147 >SB_53452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 404 Score = 28.7 bits (61), Expect = 9.6 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 27 GNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYG 68 GN + K L P A VR P + ACMR+ELYG Sbjct: 195 GNFVENMSTKHQLLKPLTARYVRFEPRTCS-QNACMRIELYG 235 >SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2492 Score = 28.7 bits (61), Expect = 9.6 Identities = 10/22 (45%), Positives = 16/22 (72%) Query: 9 YEKFTNRKLNFHMNSLIPGNVN 30 Y KF NR++ FH+++L+P N Sbjct: 499 YTKFNNREIMFHVSTLLPWTPN 520 >SB_19731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 665 Score = 28.7 bits (61), Expect = 9.6 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Query: 26 PGNVNTYTTKKTTLEAPFIASIVRVFPYAAHPRTACMRVELYGCRWKQ 73 PGN + T K A VR+ A + MR ELYGC K+ Sbjct: 215 PGNSDRNTVVKNEFSPVIQARYVRIVVQAWYTNIV-MRAELYGCEGKR 261 >SB_11784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 28.7 bits (61), Expect = 9.6 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 45 ASIVRVFPYAAHPRTACMRVELYGC 69 A VR P A H CMRVE+YGC Sbjct: 22 ARYVRFVPVAWHT-WPCMRVEIYGC 45 >SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 28.7 bits (61), Expect = 9.6 Identities = 15/54 (27%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Query: 359 VVDEDYREPYNIWRETLGRR---DKREIHDQNEYNEICEDTEFPRPYMMKRPDP 409 V+ E R +W + D R +H + E C DT P +K DP Sbjct: 1657 VMQERMRVVRELWNAGIAATLLYDSRGLHALEDVQEYCRDTGIPHLVFLKEQDP 1710 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.322 0.136 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,676,324 Number of Sequences: 59808 Number of extensions: 538941 Number of successful extensions: 1298 Number of sequences better than 10.0: 108 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 86 Number of HSP's that attempted gapping in prelim test: 1137 Number of HSP's gapped (non-prelim): 226 length of query: 428 length of database: 16,821,457 effective HSP length: 84 effective length of query: 344 effective length of database: 11,797,585 effective search space: 4058369240 effective search space used: 4058369240 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -