BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000489-TA|BGIBMGA000489-PA|IPR002490|ATPase, V0/A0 complex, 116-kDa subunit (380 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 26 0.51 AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esteras... 26 0.51 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 3.6 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 23 4.8 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 6.3 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 6.3 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 25.8 bits (54), Expect = 0.51 Identities = 24/96 (25%), Positives = 39/96 (40%), Gaps = 4/96 (4%) Query: 139 HFEMMLWRVSRGNIYYRQATEDKILKDPFTGMEIRKVAFLAVCQGEELSTRMEKIFSGFR 198 H +M+ +R I K K P T E+ +FL + +G ++S + K F Sbjct: 308 HVPIMIGYTTREGILSEVLQRPKPFK-PITDFELAVPSFLKLQRGSDISKLVAKNIKEFY 366 Query: 199 VNSYPCPESAKERLEMISQLETRMSDLEEILSKSKY 234 + + K++ + LET L EI KY Sbjct: 367 YGNEEPTDKNKDKFYL---LETDNFFLREIWRTVKY 399 >AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esterase protein. Length = 510 Score = 25.8 bits (54), Expect = 0.51 Identities = 24/96 (25%), Positives = 39/96 (40%), Gaps = 4/96 (4%) Query: 139 HFEMMLWRVSRGNIYYRQATEDKILKDPFTGMEIRKVAFLAVCQGEELSTRMEKIFSGFR 198 H +M+ +R I K K P T E+ +FL + +G ++S + K F Sbjct: 308 HVPIMIGYTTREGILSEVLQRPKPFK-PITDFELAVPSFLKLQRGSDISKLVAKNIKEFY 366 Query: 199 VNSYPCPESAKERLEMISQLETRMSDLEEILSKSKY 234 + + K++ + LET L EI KY Sbjct: 367 YGNEEPTDKNKDKFYL---LETDNFFLREIWRTVKY 399 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 3.6 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Query: 298 SETIGTNVPSFISKTTFSMSPPTFNRTNKYTHGFQVLINAYGDS 341 +E GTN + SK++ S +PP K H Q +NA G++ Sbjct: 179 TEKAGTNNNN--SKSSQSSNPPQIYPWMKRVHLGQSTVNANGET 220 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 22.6 bits (46), Expect = 4.8 Identities = 9/33 (27%), Positives = 16/33 (48%) Query: 202 YPCPESAKERLEMISQLETRMSDLEEILSKSKY 234 YP K+R E + ++ LE + K++Y Sbjct: 61 YPAGNQRKQRRERTTFTRAQLDVLEALFGKTRY 93 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 6.3 Identities = 10/41 (24%), Positives = 22/41 (53%) Query: 46 EPKALQPNEMIAYENILEKWKNDITVMSENHTKLNKSYLEL 86 E + L E++ ++++L+K+ I E ++ K +EL Sbjct: 1224 EVEFLSSTEILFWKDLLDKYLYPIDENKEEKARIAKELIEL 1264 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 6.3 Identities = 10/41 (24%), Positives = 22/41 (53%) Query: 46 EPKALQPNEMIAYENILEKWKNDITVMSENHTKLNKSYLEL 86 E + L E++ ++++L+K+ I E ++ K +EL Sbjct: 1224 EVEFLSSTEILFWKDLLDKYLYPIDENKEEKARIAKELIEL 1264 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.135 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,195 Number of Sequences: 317 Number of extensions: 3767 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 6 length of query: 380 length of database: 114,650 effective HSP length: 58 effective length of query: 322 effective length of database: 96,264 effective search space: 30997008 effective search space used: 30997008 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -