BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000487-TA|BGIBMGA000487-PA|undefined (99 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF010404-1|AAC51735.1| 4957|Homo sapiens ALR protein. 27 7.0 AF010403-1|AAC51734.1| 5262|Homo sapiens ALR protein. 27 7.0 >AF010404-1|AAC51735.1| 4957|Homo sapiens ALR protein. Length = 4957 Score = 27.5 bits (58), Expect = 7.0 Identities = 13/31 (41%), Positives = 20/31 (64%) Query: 2 EEVLSSDKQKISNLEQPSLVNEQLGQLYLDL 32 E +LSSD +IS E P + ++ L QL+ D+ Sbjct: 1288 EGMLSSDLDRISTEELPKMESKDLQQLFKDV 1318 >AF010403-1|AAC51734.1| 5262|Homo sapiens ALR protein. Length = 5262 Score = 27.5 bits (58), Expect = 7.0 Identities = 13/31 (41%), Positives = 20/31 (64%) Query: 2 EEVLSSDKQKISNLEQPSLVNEQLGQLYLDL 32 E +LSSD +IS E P + ++ L QL+ D+ Sbjct: 1593 EGMLSSDLDRISTEELPKMESKDLQQLFKDV 1623 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.306 0.123 0.304 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,090,087 Number of Sequences: 224733 Number of extensions: 141843 Number of successful extensions: 117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 115 Number of HSP's gapped (non-prelim): 2 length of query: 99 length of database: 73,234,838 effective HSP length: 76 effective length of query: 23 effective length of database: 56,155,130 effective search space: 1291567990 effective search space used: 1291567990 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (22.0 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -