BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000487-TA|BGIBMGA000487-PA|undefined (99 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 2.7 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 21 8.3 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 22.6 bits (46), Expect = 2.7 Identities = 14/43 (32%), Positives = 18/43 (41%) Query: 1 MEEVLSSDKQKISNLEQPSLVNEQLGQLYLDLQLEGVAARLTL 43 M L +Q + L+Q L NEQ Q + EG TL Sbjct: 742 MTRKLHQRQQHMKKLQQELLTNEQQLQQLAGVVFEGETEETTL 784 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 21.0 bits (42), Expect = 8.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 6 SSDKQKISNLEQPSLVNEQLGQLYLDLQLEG 36 SSD + + + + V Q+GQL +LQ G Sbjct: 439 SSDAAYLEDKRKLTKVEGQIGQLERELQSTG 469 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.306 0.123 0.304 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 49,085 Number of Sequences: 2123 Number of extensions: 1043 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 99 length of database: 516,269 effective HSP length: 55 effective length of query: 44 effective length of database: 399,504 effective search space: 17578176 effective search space used: 17578176 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -