GeneModel BLAST Result against uniref50

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000485-TA|BGIBMGA000485-PA|undefined
         (162 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q23R77 Cluster: Hydrolase, alpha/beta fold family prote...    32   5.4  

>UniRef50_Q23R77 Cluster: Hydrolase, alpha/beta fold family protein;
           n=1; Tetrahymena thermophila SB210|Rep: Hydrolase,
           alpha/beta fold family protein - Tetrahymena thermophila
           SB210
          Length = 421

 Score = 32.3 bits (70), Expect = 5.4
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 4/64 (6%)

Query: 5   QQPKEEDHEDRPVMPYVV----SSTEYSHYSAYAVFSVDLVGLAFILKVFIMDNLENSEN 60
           QQ  EE+ +D  ++ Y+     SS + + Y+  +V     +   +ILK  +  +L+N  N
Sbjct: 195 QQEIEEEEQDNGILNYIANYLSSSAKQNRYTPQSVLDKWYIPKNYILKTVVNKSLKNESN 254

Query: 61  TDKI 64
            +K+
Sbjct: 255 ENKL 258


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.306    0.127    0.345 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 119,204,850
Number of Sequences: 1657284
Number of extensions: 2942815
Number of successful extensions: 2749
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2749
Number of HSP's gapped (non-prelim): 1
length of query: 162
length of database: 575,637,011
effective HSP length: 95
effective length of query: 67
effective length of database: 418,195,031
effective search space: 28019067077
effective search space used: 28019067077
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 43 (22.0 bits)
S2: 68 (31.5 bits)