BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000485-TA|BGIBMGA000485-PA|undefined (162 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 23 1.7 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 20 8.9 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 22.6 bits (46), Expect = 1.7 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Query: 30 YSAYAVFSVDLVGLAFILKVFIMDNL 55 Y+ Y +F ++GL ILK F +D L Sbjct: 70 YAVYNIFGAFVMGLFCILK-FALDGL 94 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 20.2 bits (40), Expect = 8.9 Identities = 11/34 (32%), Positives = 16/34 (47%) Query: 17 VMPYVVSSTEYSHYSAYAVFSVDLVGLAFILKVF 50 V+P Y Y A+ +F+V L+ L I F Sbjct: 137 VVPLFFLLCIYYFYCAFIIFTVHLLFLLCIYHFF 170 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.306 0.127 0.345 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,239 Number of Sequences: 317 Number of extensions: 620 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 162 length of database: 114,650 effective HSP length: 52 effective length of query: 110 effective length of database: 98,166 effective search space: 10798260 effective search space used: 10798260 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (20.6 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -