BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000484-TA|BGIBMGA000484-PA|IPR002553|Adaptin, N-terminal (753 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 33 0.037 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 33 0.037 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 33 0.037 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 33 0.037 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 33 0.037 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 33 0.037 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 33 0.037 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 33 0.037 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 33 0.037 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 33 0.037 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 33 0.037 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 33 0.037 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 33 0.037 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 33 0.037 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 28 0.79 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 28 0.79 AY604021-1|AAT38515.1| 118|Anopheles gambiae LZ9988P protein. 27 1.8 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 27 1.8 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 27 1.8 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 27 1.8 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 27 1.8 AY146735-1|AAO12095.1| 149|Anopheles gambiae odorant-binding pr... 27 1.8 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 27 1.8 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 27 1.8 AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14... 26 3.2 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 25 7.3 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 25 7.3 AF457566-1|AAL68796.1| 147|Anopheles gambiae multiprotein bridg... 25 7.3 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.037 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 400 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 452 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.037 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 400 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 452 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.037 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 400 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 452 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.037 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 400 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 452 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.037 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 400 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 452 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.037 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 400 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 452 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.037 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 400 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 452 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.037 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 400 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 452 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.037 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 400 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 452 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.037 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 400 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 452 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.037 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 400 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 452 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.037 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 400 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 452 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.037 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 400 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 452 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 32.7 bits (71), Expect = 0.037 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 400 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 452 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 412 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 465 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 28.3 bits (60), Expect = 0.79 Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 479 SPVEIETRKAPVVSREEQYTEQLQAIPGIEKLG 511 +P ET++AP R + YT+Q +P + G Sbjct: 46 APYPTETQRAPAYGRSQAYTQQPAPVPLAPRFG 78 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 28.3 bits (60), Expect = 0.79 Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 479 SPVEIETRKAPVVSREEQYTEQLQAIPGIEKLG 511 +P ET++AP R + YT+Q +P + G Sbjct: 46 APYPTETQRAPAYGRSQAYTQQPAPVPLAPRFG 78 >AY604021-1|AAT38515.1| 118|Anopheles gambiae LZ9988P protein. Length = 118 Score = 27.1 bits (57), Expect = 1.8 Identities = 14/39 (35%), Positives = 20/39 (51%) Query: 493 REEQYTEQLQAIPGIEKLGPLFKSCEAIDLTEPETEYRV 531 +EE TEQL E++ L K+C + ET Y+V Sbjct: 68 QEETITEQLSKFMPRERIESLVKNCNFQEADACETAYKV 106 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 27.1 bits (57), Expect = 1.8 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 479 SPVEIETRKAPVVSREEQYTEQLQAIPGIEKLG 511 +P ET+++P R + YT+Q +P + G Sbjct: 45 APYPTETQRSPAYGRSQAYTQQPAPVPLAPRFG 77 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 27.1 bits (57), Expect = 1.8 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 479 SPVEIETRKAPVVSREEQYTEQLQAIPGIEKLG 511 +P ET+++P R + YT+Q +P + G Sbjct: 45 APYPTETQRSPAYGRSQAYTQQPAPVPLAPRFG 77 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 27.1 bits (57), Expect = 1.8 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 479 SPVEIETRKAPVVSREEQYTEQLQAIPGIEKLG 511 +P ET+++P R + YT+Q +P + G Sbjct: 45 APYPTETQRSPAYGRSQAYTQQPAPVPLAPRFG 77 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 27.1 bits (57), Expect = 1.8 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 479 SPVEIETRKAPVVSREEQYTEQLQAIPGIEKLG 511 +P ET+++P R + YT+Q +P + G Sbjct: 45 APYPTETQRSPAYGRSQAYTQQPAPVPLAPRFG 77 >AY146735-1|AAO12095.1| 149|Anopheles gambiae odorant-binding protein AgamOBP25 protein. Length = 149 Score = 27.1 bits (57), Expect = 1.8 Identities = 14/39 (35%), Positives = 20/39 (51%) Query: 493 REEQYTEQLQAIPGIEKLGPLFKSCEAIDLTEPETEYRV 531 +EE TEQL E++ L K+C + ET Y+V Sbjct: 92 QEETITEQLSKFMPRERIESLVKNCNFQEADACETAYKV 130 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 27.1 bits (57), Expect = 1.8 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 479 SPVEIETRKAPVVSREEQYTEQLQAIPGIEKLG 511 +P ET+++P R + YT+Q +P + G Sbjct: 117 APYPTETQRSPAYGRSQAYTQQPAPVPLAPRFG 149 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 27.1 bits (57), Expect = 1.8 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 479 SPVEIETRKAPVVSREEQYTEQLQAIPGIEKLG 511 +P ET+++P R + YT+Q +P + G Sbjct: 116 APYPTETQRSPAYGRSQAYTQQPAPVPLAPRFG 148 >AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14A protein. Length = 365 Score = 26.2 bits (55), Expect = 3.2 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Query: 546 FEC-LNTLSDQLLEKVYVRLDSIPGYKI 572 FEC L+TL+D+++ Y +D P Y + Sbjct: 102 FECGLDTLADRIIGGNYTAIDEFPWYAL 129 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 25.0 bits (52), Expect = 7.3 Identities = 12/35 (34%), Positives = 18/35 (51%) Query: 458 QSEPFNIAAVPTAEEPQEPKESPVEIETRKAPVVS 492 Q+ P + P A P P S + + +RK+P VS Sbjct: 71 QTHPSVPSLKPVAGAPAAPGPSALPLSSRKSPTVS 105 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 25.0 bits (52), Expect = 7.3 Identities = 12/35 (34%), Positives = 18/35 (51%) Query: 458 QSEPFNIAAVPTAEEPQEPKESPVEIETRKAPVVS 492 Q+ P + P A P P S + + +RK+P VS Sbjct: 71 QTHPSVPSLKPVAGAPAAPGPSALPLSSRKSPTVS 105 >AF457566-1|AAL68796.1| 147|Anopheles gambiae multiprotein bridging factor-like proteinprotein. Length = 147 Score = 25.0 bits (52), Expect = 7.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Query: 427 PQLINDYIINIQVPNPVLLEK 447 PQ++NDY VPN ++L K Sbjct: 103 PQIVNDYEAGRGVPNNLILGK 123 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.134 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 659,792 Number of Sequences: 2123 Number of extensions: 25205 Number of successful extensions: 116 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 73 Number of HSP's gapped (non-prelim): 30 length of query: 753 length of database: 516,269 effective HSP length: 69 effective length of query: 684 effective length of database: 369,782 effective search space: 252930888 effective search space used: 252930888 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -