BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000484-TA|BGIBMGA000484-PA|IPR002553|Adaptin, N-terminal (753 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 24 3.3 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 23 7.7 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 24.2 bits (50), Expect = 3.3 Identities = 13/45 (28%), Positives = 23/45 (51%) Query: 96 RLSTVKLITKLARTPVRSPYTLCLQIRFAAKLAEEDPSEASEPYL 140 R T+ +I +ARTP++S +++ + A A + P E L Sbjct: 4 REETILVIPTMARTPLKSSFSISSILPETALEAPKSPENHPETEL 48 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 23.0 bits (47), Expect = 7.7 Identities = 8/21 (38%), Positives = 14/21 (66%) Query: 323 LAHLCEFIEDCEHVTLAVRIL 343 + + C+F+ +C H TL + IL Sbjct: 138 IENYCQFLYNCFHSTLLLMIL 158 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.134 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,708 Number of Sequences: 317 Number of extensions: 5536 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 2 length of query: 753 length of database: 114,650 effective HSP length: 62 effective length of query: 691 effective length of database: 94,996 effective search space: 65642236 effective search space used: 65642236 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -